Gene Information

Name : merR (HCM1.151c)
Accession : NP_569360.1
Strain :
Genome accession: NC_003384
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 114531 - 114986 bp
Length : 456 bp
Strand : -
Note : similar to (EMBL:Z00027) merR from Pseudomonas aeruginosa plasmid pVS1; similar to HCM1.245

DNA sequence :
ATGCAAATTAATTTTGAGAATCTGACCATTGGCGTTTTTGCCAAGGCGGCCGGGGTCAATGTGGAGACCATCCGGTTCTA
CCAGCGCAAGGGCCTGCTGCCGGAGCCAGACAAGCCCTATGGCAGCATTCGCCGCTATGGCGAGGCGGATGTAACACGAG
TGCGGTTCGTGAAATCGGCCCAGCGGCTGGGCTTTAGCCTGGACGAAATCGCCGAGCTACTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGCGGCCTGGCCGAGCACAAGCTCAAGGATGTGCGCGAGAAGATGGCCGACTTGGCACGCATGGA
GGCCGTGCTGTCTGAACTGGTGTGCGCCTGCCATGCGCGGAAAGGGAACGTTTTCTGCCCGCTGATTGCGTCACTGCAAG
ACGGAACGAAGCTCGCTGCATCGGCGCGGGGGAGTCACGGGGTGACTACGCCTTAG

Protein sequence :
MQINFENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASGLAEHKLKDVREKMADLARMEAVLSELVCACHARKGNVFCPLIASLQDGTKLAASARGSHGVTTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-66 99
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-66 99
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-56 90
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-56 90
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-56 90
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-56 90
merR AGK07083.1 MerR Not tested SGI1 Protein 8e-56 89
merR AGK07025.1 MerR Not tested SGI1 Protein 8e-56 89
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-47 77
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-44 72
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-27 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR NP_569360.1 transcriptional regulator MerR BAC0232 Protein 4e-58 93
merR NP_569360.1 transcriptional regulator MerR BAC0687 Protein 4e-58 93
merR NP_569360.1 transcriptional regulator MerR BAC0688 Protein 5e-57 92
merR NP_569360.1 transcriptional regulator MerR BAC0689 Protein 5e-60 89
merR NP_569360.1 transcriptional regulator MerR BAC0684 Protein 2e-58 89
merR NP_569360.1 transcriptional regulator MerR BAC0683 Protein 4e-58 87
merR NP_569360.1 transcriptional regulator MerR BAC0686 Protein 7e-55 85