Gene Information

Name : BMEII0712 (BMEII0712)
Accession : NP_541690.1
Strain :
Genome accession: NC_003318
Putative virulence/resistance : Unknown
Product : transcriptional regulator
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 752222 - 752575 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
GTGATCTCACTTGGATCGGATTTGCGGATCATGATTGCTTCAAAGCCGGTGGACTTCAGGAAGGGCATCAATGGGCTGGC
GGCGCTGGTATCGACTGCGCTCGGCCCCAACCCATACTCAGGCGACATATATGTCTTCCGCAGCAAGCGTAACGATCGTC
TGAAGATGGTCGTTTGGGATGGCAGCGGCATGGTTCTGTTGACCAAAGTTTTGGAGGATCGGCGTTTTATCTGGCCGGCT
GTTCACGCTGGAGCCGTTCGTCTCAGCGCCAGCGAATTGGCGCTTTTGCTCGATGGCCTGGACTGGACAAGAGTGGAGAA
GAAGCCAGTCAAACGGCCCGCAAAAACAGCGTGA

Protein sequence :
MISLGSDLRIMIASKPVDFRKGINGLAALVSTALGPNPYSGDIYVFRSKRNDRLKMVVWDGSGMVLLTKVLEDRRFIWPA
VHAGAVRLSASELALLLDGLDWTRVEKKPVKRPAKTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-20 49
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-19 48
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-19 48
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-18 47
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-18 47
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-18 46
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-11 44
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-16 43
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-17 43
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-17 43
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-17 43
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-16 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-17 43
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-16 43
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-16 43
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-16 43
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-16 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-16 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-16 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-16 42
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-19 41
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMEII0712 NP_541690.1 transcriptional regulator VFG1737 Protein 3e-19 46
BMEII0712 NP_541690.1 transcriptional regulator VFG1517 Protein 7e-12 44
BMEII0712 NP_541690.1 transcriptional regulator VFG1052 Protein 7e-17 43
BMEII0712 NP_541690.1 transcriptional regulator VFG1709 Protein 4e-17 43
BMEII0712 NP_541690.1 transcriptional regulator VFG0792 Protein 4e-17 43
BMEII0712 NP_541690.1 transcriptional regulator VFG1698 Protein 3e-17 42