Gene Information

Name : fliQ (BMEII0165)
Accession : NP_541142.1
Strain :
Genome accession: NC_003318
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 176715 - 176981 bp
Length : 267 bp
Strand : +
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence :
GTGAACGAGGCTGATGCGCTTGATATCGTCAATTCGGCGATCTGGACCGTGCTGACCGCAAGCGGGCCGGCGGTGCTTGC
CGCCATGCTTGCGGGCATTGGGATTGCGCTGTTTCAGGCGCTGACGCAAATTCAGGAAATGACCCTGACCTTCGTGCCGA
AAATCATCGTCATTTTCGTCGTCCTGGCGCTGACGGCACCTTTTGTCGGTGCGCAGATCAATGCTTTCACGCTGCTTGCC
TATTCCCGCATCGAAAAGGGTTTTTAA

Protein sequence :
MNEADALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFVVLALTAPFVGAQINAFTLLA
YSRIEKGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
escS CAC81848.1 EscS protein Virulence LEE II Protein 5e-04 42
unnamed AAL06355.1 EscS Virulence LEE Protein 3e-04 42
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 8e-04 42
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 8e-04 42
escS CAI43888.1 EscS protein Virulence LEE Protein 6e-04 42
escS AAK26701.1 EscS Virulence LEE Protein 5e-04 42
escS AAL57528.1 EscS Virulence LEE Protein 5e-04 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ NP_541142.1 flagellar biosynthesis protein FliQ VFG0187 Protein 0.36 46