Gene Information

Name : copR (RSp0655)
Accession : NP_522216.1
Strain :
Genome accession: NC_003296
Putative virulence/resistance : Virulence
Product : two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 833513 - 834199 bp
Length : 687 bp
Strand : -
Note : Product confidence : probable; Gene name confidence : predicted by Codon_usage; predicted by FrameD

DNA sequence :
ATGAAGCTGCTAGTCGTCGAAGACGAAGCCAAGACCGGCGAATACCTCCAGCAGGGCCTGACCGAGGCCGGGTTCGTGGT
GGATCTCGCCCGCAACGGCGTGGACGGCCTGCACCTCGCCACGATGGGCGACTACGACCTGCTGGTGCTCGACGTGATGC
TGCCCGACCTGGACGGCTGGCAGGTCGTGCAATCGCTGCGCGCGGCCGCGTGCGCGGTGCCGGTGCTGTTCCTGACCGCG
CGCGACAGCGTGGGCGACCGGGTCAAGGGGCTCGAGCTGGGCGCCGACGATTACCTGGTCAAGCCGTTCGCCTTCGCGGA
GCTGCTGGCGCGGGTCCGCACCCTGCTGCGCCGGGGCAGCACGCCGGTCGCGCTCGACCGCATCCAGATCGCCGACCTCG
TGCTCGACCTGGCCCGCCGCCGGGCCTCGCGCTCGGGGCAGCGGATCGCGCTGACCAGCAAGGAGTTCGCCCTGCTCGAA
CTGCTGGCCCGCCGCCGCGGCGAAGTGCTGCCGCGCTCGCTGATCGCCTCCCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTGATCGACGTCGCCATCCGCCGGCTGCGCGCCAAGATCGACGACGACTTCACGCCGAAGCTGATCCAGACGG
TGCGCGGCATGGGCTACGTGCTCGAAGACCCGGAGGACGCGGCATGA

Protein sequence :
MKLLVVEDEAKTGEYLQQGLTEAGFVVDLARNGVDGLHLATMGDYDLLVLDVMLPDLDGWQVVQSLRAAACAVPVLFLTA
RDSVGDRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSTPVALDRIQIADLVLDLARRRASRSGQRIALTSKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFTPKLIQTVRGMGYVLEDPEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-44 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-44 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR NP_522216.1 two component response regulator transcription regulator protein BAC0083 Protein 1e-56 71
copR NP_522216.1 two component response regulator transcription regulator protein BAC0111 Protein 2e-61 70
copR NP_522216.1 two component response regulator transcription regulator protein BAC0638 Protein 7e-59 70
copR NP_522216.1 two component response regulator transcription regulator protein BAC0197 Protein 1e-53 66
copR NP_522216.1 two component response regulator transcription regulator protein BAC0308 Protein 3e-53 66
copR NP_522216.1 two component response regulator transcription regulator protein BAC0125 Protein 2e-50 65
copR NP_522216.1 two component response regulator transcription regulator protein BAC0347 Protein 4e-52 64
copR NP_522216.1 two component response regulator transcription regulator protein NC_002516.2.879194.p Protein 3e-21 42
copR NP_522216.1 two component response regulator transcription regulator protein NC_002952.2859905.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_007622.3794472.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_002745.1124361.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_009782.5559369.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_002951.3237708.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_002758.1121668.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_009641.5332272.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_013450.8614421.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein NC_007793.3914279.p0 Protein 2e-22 41
copR NP_522216.1 two component response regulator transcription regulator protein AE000516.2.gene3505. Protein 3e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR NP_522216.1 two component response regulator transcription regulator protein VFG0596 Protein 4e-45 62
copR NP_522216.1 two component response regulator transcription regulator protein VFG1389 Protein 6e-27 48
copR NP_522216.1 two component response regulator transcription regulator protein VFG1390 Protein 5e-33 47
copR NP_522216.1 two component response regulator transcription regulator protein VFG1386 Protein 2e-25 42