Gene Information

Name : RSp1442 (RS03101)
Accession : NP_523001.1
Strain :
Genome accession: NC_003296
Putative virulence/resistance : Virulence
Product : two-component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1811696 - 1812376 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAACATTCTCGTCATTGAAGACGACGCCCGCGTCTCGGATTTCCTCTCGCGCGGCCTGCGGGCCGAAGGCTATCGCGT
GCTGCTCGCGCGCACCGGCCCCGAAGGCCTGCAGCTGGCCCGCACCGGCGAGCCCGCGCTGCTGCTGCTCGACCTGATGC
TGCCCGGCATGAGCGGCCTGGAGCTGTGCCAGACCCTGCGCGCGGAACGCAACCACGTGCCGATCCTGATGCTCACCTCG
CTGACCGACATCGACGATCGGGTCACCGGCCTGCGGCTGGGCGCGGACGACTACATGACCAAGCCCTTCGCGTTCGAAGA
GCTGCTCGCGCGCATCGAGGCGCTGCTGCGCCGCGGGCGCGAGCAGCGGCCGAAGGTCAACGTATTGCAGGTGGCGGACC
TGGTGCTCGACCGCGAGCGCATGCAGGTCACCCGCGCCGGCAAGCCCATCGCGCTCACCGCCAAGGAGCTGGCCTTCCTG
GAGCTGCTGATGAGCGCGCCCGGCCGCATCTACAGCCGCGAGCGCATCCTGTCGAACGTCTGGGGCGCCAACGAGGATCC
GCTGACCAACATCGTCGACGTCTACGTGCGCCGCCTGCGCAGCAAGATCGACGAGGGCCAGCCGGTGCCCCTGCTCAAGA
CCGTGCGCGGACTCGGCTATCGGCTCGACAGCGAGCCCTGA

Protein sequence :
MNILVIEDDARVSDFLSRGLRAEGYRVLLARTGPEGLQLARTGEPALLLLDLMLPGMSGLELCQTLRAERNHVPILMLTS
LTDIDDRVTGLRLGADDYMTKPFAFEELLARIEALLRRGREQRPKVNVLQVADLVLDRERMQVTRAGKPIALTAKELAFL
ELLMSAPGRIYSRERILSNVWGANEDPLTNIVDVYVRRLRSKIDEGQPVPLLKTVRGLGYRLDSEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-26 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0083 Protein 4e-29 47
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0197 Protein 1e-26 47
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0638 Protein 6e-23 47
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0111 Protein 1e-31 46
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0308 Protein 1e-27 46
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0347 Protein 2e-26 45
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein BAC0125 Protein 4e-30 44
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein HE999704.1.gene1528. Protein 1e-25 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein VFG0596 Protein 4e-27 45
RSp1442 NP_523001.1 two-component response regulator transcription regulator protein VFG1390 Protein 2e-29 44