Gene Information

Name : all4503 (all4503)
Accession : NP_488543.1
Strain : Nostoc sp. PCC 7120
Genome accession: NC_003272
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5392988 - 5393749 bp
Length : 762 bp
Strand : -
Note : ORF_ID:all4503

DNA sequence :
GTGATATCAATGTACACCAGTGAATCGATCAAGTATTCGGCTAGAACAGAGATTGGACAAACCAGTCGGATTCTGGTAGT
GGAAGATGAAGAACTCATCCAAGAAATGCTAGCAGTAGCACTGGAAGAGGAAGGTTATGGGGTAGTAACGGCTGCTGATG
GCAGGTCAGCTGTAGAGTATCTCAAAAGTTTTGACCCAAACGGAGGAGATTTTCCCTTTGATTTGGTGATTCTCGATTTG
ATGTTACCCCAAATTAATGGCTTAGATATCTGCCGTTTGTTGCGTCATCAAGGCAACCCAGTACCGATTTTGATGCTCAG
TGCCAAAGGTAGTGAAACCGATCGCGTGTTAGGTTTAGAAGTAGGGGCAGATGACTATTTAACTAAACCCTTTAGTATGC
GGGAGTTGGTGGCACGTTGTCGCGCTTTACTCCGTCGTCAGCGTCTCATCACTTTACCCCAATTACCTGTACTGAAATTC
AAAGATGTGACTTTAAATCCTCAAGAGTGTCGGGTCTTGGTACGAGGACAAGAGGTAAATCTTTCACCCAAAGAGTTTCG
CTTGTTGGAACTGTTCATGAGTTACGCCCGTCGAGTATGGTCACGGGAACAGTTGCTAGACCAGGTTTGGGGGCCGGATT
TTGTCGGCGATAGCAAAACAGTGGATGTTCACATTCGTTGGTTGCGAGAGAAATTGGAACAAGACCCCAGTCACCCAGAA
TATATTGTGACTGTAAGAGGATTTGGATATCGATTCGGATAA

Protein sequence :
MISMYTSESIKYSARTEIGQTSRILVVEDEELIQEMLAVALEEEGYGVVTAADGRSAVEYLKSFDPNGGDFPFDLVILDL
MLPQINGLDICRLLRHQGNPVPILMLSAKGSETDRVLGLEVGADDYLTKPFSMRELVARCRALLRRQRLITLPQLPVLKF
KDVTLNPQECRVLVRGQEVNLSPKEFRLLELFMSYARRVWSREQLLDQVWGPDFVGDSKTVDVHIRWLREKLEQDPSHPE
YIVTVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-31 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
all4503 NP_488543.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_012469.1.7685629. Protein 9e-37 46
all4503 NP_488543.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-35 46
all4503 NP_488543.1 two-component response regulator AE000516.2.gene3505. Protein 4e-37 44
all4503 NP_488543.1 two-component response regulator AE016830.1.gene1681. Protein 4e-43 43
all4503 NP_488543.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-29 42
all4503 NP_488543.1 two-component response regulator FJ349556.1.orf0.gene Protein 7e-34 42
all4503 NP_488543.1 two-component response regulator BAC0111 Protein 5e-28 41
all4503 NP_488543.1 two-component response regulator HE999704.1.gene2815. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
all4503 NP_488543.1 two-component response regulator VFG1563 Protein 3e-31 44
all4503 NP_488543.1 two-component response regulator VFG1702 Protein 2e-31 44
all4503 NP_488543.1 two-component response regulator VFG1390 Protein 2e-33 43