Gene Information

Name : alr1194 (alr1194)
Accession : NP_485237.1
Strain : Nostoc sp. PCC 7120
Genome accession: NC_003272
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1406796 - 1407482 bp
Length : 687 bp
Strand : +
Note : ORF_ID:alr1194

DNA sequence :
ATGACAACACACATTCTTTTGGTTGAAGATGAAGTTAAATTAGCGCGATTTGTCGAATTGGAACTAAGTAGTGAAGGTTA
CAAAGTTAGTGTCGCTCATGATGGAATTACTGGACTAACCTTGGCGCGAGAGTCAACACCCGATTTAGCGGTTCTTGATT
GGATGTTACCAGGACTATCAGGTTTAGAAATTTGTCGCCGTCTGCGAGCAACGGGTAATTCAATACCTGTAATTTTGTTA
ACTGCCAGAGACGAAGTGAGCGATCGCGTGGCAGGATTAGATGCAGGAGCTGATGATTATGTAGTCAAACCCTTCAGTAT
TGAGGAATTATTAGCAAGAATTCGCGCCCATCTGCGCCGCACTCAAGAAACAGATGAAGACTTGTTGCAGTTTGAAGACC
TAAGTTTAAATCGCCGCACTCGTGAAGTGTTTCGAGGTAACCGAGCGGTTGAATTAACAGCAAAAGAGTTTGATTTATTA
GAGTATCTTCTTTCCTATCCCCGTCAGGTTTTTACCAGAGATCAAATTCTCGAAAAAGTTTGGGGTTATGATTTTATGGG
AGATTCCAACATCATCGAGGTTTATATCCGTTATTTGCGGCTTAAATTGGAAGAAAATAACGAAAAGCGGCTGGTTCATA
CAGTACGTGGCGTAGGATATGCACTACGGGAGTATCCCAACAAATAA

Protein sequence :
MTTHILLVEDEVKLARFVELELSSEGYKVSVAHDGITGLTLARESTPDLAVLDWMLPGLSGLEICRRLRATGNSIPVILL
TARDEVSDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRTQETDEDLLQFEDLSLNRRTREVFRGNRAVELTAKEFDLL
EYLLSYPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEENNEKRLVHTVRGVGYALREYPNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
alr1194 NP_485237.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-48 50
alr1194 NP_485237.1 two-component response regulator AE015929.1.gene1106. Protein 8e-45 50
alr1194 NP_485237.1 two-component response regulator HE999704.1.gene1528. Protein 2e-45 48
alr1194 NP_485237.1 two-component response regulator BAC0083 Protein 3e-40 45
alr1194 NP_485237.1 two-component response regulator BAC0197 Protein 7e-38 45
alr1194 NP_485237.1 two-component response regulator AE000516.2.gene3505. Protein 2e-40 45
alr1194 NP_485237.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-41 43
alr1194 NP_485237.1 two-component response regulator NC_009782.5559369.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_002951.3237708.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_002758.1121668.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_009641.5332272.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_013450.8614421.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_007793.3914279.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_003923.1003749.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-41 43
alr1194 NP_485237.1 two-component response regulator NC_002745.1124361.p0 Protein 8e-41 43
alr1194 NP_485237.1 two-component response regulator BAC0347 Protein 2e-38 43
alr1194 NP_485237.1 two-component response regulator BAC0125 Protein 2e-41 43
alr1194 NP_485237.1 two-component response regulator BAC0308 Protein 7e-40 43
alr1194 NP_485237.1 two-component response regulator CP000034.1.gene3671. Protein 9e-36 43
alr1194 NP_485237.1 two-component response regulator BAC0111 Protein 4e-39 42
alr1194 NP_485237.1 two-component response regulator BAC0638 Protein 3e-34 42
alr1194 NP_485237.1 two-component response regulator CP001918.1.gene5135. Protein 8e-18 41
alr1194 NP_485237.1 two-component response regulator BAC0288 Protein 1e-32 41
alr1194 NP_485237.1 two-component response regulator NC_002516.2.879194.p Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
alr1194 NP_485237.1 two-component response regulator VFG1390 Protein 6e-56 55
alr1194 NP_485237.1 two-component response regulator VFG1389 Protein 1e-40 47
alr1194 NP_485237.1 two-component response regulator VFG0596 Protein 1e-35 46
alr1194 NP_485237.1 two-component response regulator VFG1386 Protein 1e-45 44
alr1194 NP_485237.1 two-component response regulator VFG1563 Protein 6e-35 41
alr1194 NP_485237.1 two-component response regulator VFG1702 Protein 5e-35 41