Name : rpmJ (BF3980) Accession : YP_213559.1 Strain : Bacteroides fragilis NCTC 9343 Genome accession: NC_003228 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 4695543 - 4695659 bp Length : 117 bp Strand : - Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAGTAAGAGCATCATTAAAGAAACGTACGCCAGAATGTAAGATCGTTAGACGTAATGGCCGTTTGTATGTTATTAA CAAGAAAAATCCTAAGTATAAACAACGTCAAGGATAA Protein sequence : MKVRASLKKRTPECKIVRRNGRLYVINKKNPKYKQRQG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 9e-06 | 58 |