Gene Information

Name : phoP (lin2644)
Accession : NP_471974.1
Strain : Listeria innocua Clip11262
Genome accession: NC_003212
Putative virulence/resistance : Virulence
Product : two-component response phosphate regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2661314 - 2662024 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
TTGGTAAAAATTCTTGTAGTTGATGATGAGGCTTCTATTGTTACCTTGTTGCAATTTAATATTGAAAAAGCTGGGTTTGA
TGTAGTCACAGCTGAAGATGGTAGAACTGGGTACGAACTTGCTCTATCGGAAAAACCAGATTTAATTGTACTTGATTTAA
TGCTTCCTGAAATGGACGGAATTGAAGTAACGAAAAAACTCCGCCAAGATAAAGTTGGAGTTCCAATACTAATGTTAACT
GCCAAAGATGAAGAACTAGATAAGATCATTGGTTTAGAGTTAGGTGCAGACGATTATATGACAAAGCCGTTTAGCCCTAG
AGAAGTTGTCGCAAGGATTAAAGCCATTTTAAGACGGACAGAAGGCAAGGCCGAAGTTACCGAAGAAAAAACGGAAGATA
CAGAAGCGACTATTTTAATTGGTGATTTGAAAATTTTACCGGATAGTTATGAAGTATATTTGCAAGATGATTTATTAGAT
TTAACGCCGAAAGAATTTGAGCTGCTCTTATTCCTAGCCAATCATCGCGGCAAAGTTTTTTCGAGAGATCAATTGCTTGA
TACGGTTTGGAATTATGATTATGTAGGTGAAACGCGGATTGTAGATGTTCACGTTAGCCATTTACGCGATAAAATTGAAC
TAGATACTAAACAACCGAAATACATTAAAACAATACGTGGATTCGGTTATAAAATGGAGAATGTAAAATAA

Protein sequence :
MVKILVVDDEASIVTLLQFNIEKAGFDVVTAEDGRTGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQDKVGVPILMLT
AKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEVTEEKTEDTEATILIGDLKILPDSYEVYLQDDLLD
LTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-41 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP NP_471974.1 two-component response phosphate regulator HE999704.1.gene2815. Protein 4e-105 98
phoP NP_471974.1 two-component response phosphate regulator NC_002952.2859905.p0 Protein 1e-67 60
phoP NP_471974.1 two-component response phosphate regulator NC_013450.8614421.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_007793.3914279.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_007622.3794472.p0 Protein 1e-67 60
phoP NP_471974.1 two-component response phosphate regulator NC_002745.1124361.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_009782.5559369.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_002951.3237708.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_003923.1003749.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_002758.1121668.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator NC_009641.5332272.p0 Protein 8e-68 60
phoP NP_471974.1 two-component response phosphate regulator AE016830.1.gene1681. Protein 6e-69 58
phoP NP_471974.1 two-component response phosphate regulator NC_012469.1.7685629. Protein 3e-56 55
phoP NP_471974.1 two-component response phosphate regulator NC_012469.1.7686381. Protein 1e-60 50
phoP NP_471974.1 two-component response phosphate regulator AE000516.2.gene3505. Protein 8e-39 44
phoP NP_471974.1 two-component response phosphate regulator AF162694.1.orf4.gene Protein 7e-38 43
phoP NP_471974.1 two-component response phosphate regulator CP001485.1.gene721.p Protein 6e-36 42
phoP NP_471974.1 two-component response phosphate regulator CP004022.1.gene3215. Protein 1e-36 42
phoP NP_471974.1 two-component response phosphate regulator EU250284.1.orf4.gene Protein 2e-38 41
phoP NP_471974.1 two-component response phosphate regulator NC_005054.2598277.p0 Protein 3e-39 41
phoP NP_471974.1 two-component response phosphate regulator NC_014475.1.orf0.gen Protein 3e-39 41
phoP NP_471974.1 two-component response phosphate regulator NC_002695.1.915041.p Protein 3e-32 41
phoP NP_471974.1 two-component response phosphate regulator CP000647.1.gene4257. Protein 2e-32 41
phoP NP_471974.1 two-component response phosphate regulator CP000034.1.gene3834. Protein 3e-32 41
phoP NP_471974.1 two-component response phosphate regulator CP001138.1.gene4273. Protein 2e-32 41
phoP NP_471974.1 two-component response phosphate regulator BAC0533 Protein 2e-32 41
phoP NP_471974.1 two-component response phosphate regulator AM180355.1.gene1830. Protein 1e-37 41
phoP NP_471974.1 two-component response phosphate regulator CP001918.1.gene5135. Protein 4e-29 41
phoP NP_471974.1 two-component response phosphate regulator CP000034.1.gene3671. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP NP_471974.1 two-component response phosphate regulator VFG1563 Protein 4e-41 42
phoP NP_471974.1 two-component response phosphate regulator VFG1702 Protein 3e-41 42
phoP NP_471974.1 two-component response phosphate regulator VFG1386 Protein 5e-39 42
phoP NP_471974.1 two-component response phosphate regulator VFG1389 Protein 4e-33 41