Gene Information

Name : lin1542 (lin1542)
Accession : NP_470878.1
Strain : Listeria innocua Clip11262
Genome accession: NC_003212
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1542280 - 1542966 bp
Length : 687 bp
Strand : +
Note : similar to two-component response regulators

DNA sequence :
ATGAAACTACTTATGATAGAAGATAATGTCAGCGTTTGTGAAATGATAGAAATGTTCTTTATGAAAGAAGAAATTGATGC
TACGTTTGTGCATGATGGCAAACTTGGTTATGAAACATTTTTTAAGGATGATTTTGATATTGCAATTATTGATTTAATGC
TGCCAAATATGGACGGAATGACAATTTGCCGTAAAATCCGTGAAGTTAGTGATGTTCCGATTATTATTTTAACGGCAAAA
GAGTCTGAATCTGATCAAGTGCTTGGTCTTGAAATGGGCGCTGATGATTATGTTACGAAACCATTTAGCCCACTTACATT
AATGGCGCGTATCAAAGCTGTTACTCGTCGAAAAAACAATCATACGACGACTGAAAATGATGAAGACATTCTAGAAACAA
CTTATTTTAAAATTAGTAAGCGCACCCGGGAAATTTTTTATCAAGGTGAGCTGCTTGATGCCTTGACTCCGAAAGAATTT
GATTTGCTTTACTTTCTAATGCAACATCCGCGTCAAGTTTTTTCAAGAGAACAGTTACTCGAGCAAGTCTGGGGTTATCA
ATTTTACGGGGATGAGCGTACAGTGGATGTTCATATCAAACGTTTACGCCAAAAAATCGCAACAGACACGAAGCCATTTT
TACACACTGTTTGGGGTGTAGGCTATAAATTTGATGAAACGGAATGA

Protein sequence :
MKLLMIEDNVSVCEMIEMFFMKEEIDATFVHDGKLGYETFFKDDFDIAIIDLMLPNMDGMTICRKIREVSDVPIIILTAK
ESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNNHTTTENDEDILETTYFKISKRTREIFYQGELLDALTPKEF
DLLYFLMQHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATDTKPFLHTVWGVGYKFDETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-32 48
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-32 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lin1542 NP_470878.1 hypothetical protein NC_012469.1.7685629. Protein 1e-34 47
lin1542 NP_470878.1 hypothetical protein NC_012469.1.7686381. Protein 1e-38 46
lin1542 NP_470878.1 hypothetical protein NC_002952.2859905.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_013450.8614421.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_007793.3914279.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_003923.1003749.p0 Protein 8e-37 46
lin1542 NP_470878.1 hypothetical protein NC_002745.1124361.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_009782.5559369.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_002951.3237708.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_007622.3794472.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_002758.1121668.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein NC_009641.5332272.p0 Protein 9e-37 46
lin1542 NP_470878.1 hypothetical protein FJ349556.1.orf0.gene Protein 1e-35 44
lin1542 NP_470878.1 hypothetical protein AF155139.2.orf0.gene Protein 1e-32 44
lin1542 NP_470878.1 hypothetical protein CP000647.1.gene2531. Protein 1e-27 44
lin1542 NP_470878.1 hypothetical protein CP001918.1.gene3444. Protein 4e-28 44
lin1542 NP_470878.1 hypothetical protein CP000034.1.gene3671. Protein 2e-34 44
lin1542 NP_470878.1 hypothetical protein AE016830.1.gene1681. Protein 2e-35 43
lin1542 NP_470878.1 hypothetical protein HE999704.1.gene2815. Protein 2e-41 43
lin1542 NP_470878.1 hypothetical protein DQ212986.1.gene4.p01 Protein 1e-29 43
lin1542 NP_470878.1 hypothetical protein AM180355.1.gene1830. Protein 1e-29 43
lin1542 NP_470878.1 hypothetical protein NC_002695.1.916589.p Protein 4e-28 43
lin1542 NP_470878.1 hypothetical protein BAC0039 Protein 4e-28 43
lin1542 NP_470878.1 hypothetical protein CP000034.1.gene2186. Protein 4e-28 43
lin1542 NP_470878.1 hypothetical protein NC_010400.5986590.p0 Protein 5e-35 42
lin1542 NP_470878.1 hypothetical protein NC_011595.7057856.p0 Protein 4e-35 42
lin1542 NP_470878.1 hypothetical protein NC_010410.6002989.p0 Protein 4e-35 42
lin1542 NP_470878.1 hypothetical protein AE015929.1.gene1106. Protein 2e-26 42
lin1542 NP_470878.1 hypothetical protein NC_007793.3914065.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_002758.1121390.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_010079.5776364.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_002952.2859858.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_007622.3794948.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_003923.1003417.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_013450.8614146.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_002951.3238224.p0 Protein 3e-30 42
lin1542 NP_470878.1 hypothetical protein NC_014475.1.orf0.gen Protein 7e-32 42
lin1542 NP_470878.1 hypothetical protein NC_005054.2598277.p0 Protein 7e-32 42
lin1542 NP_470878.1 hypothetical protein CP001138.1.gene2239. Protein 5e-27 42
lin1542 NP_470878.1 hypothetical protein BAC0596 Protein 5e-27 42
lin1542 NP_470878.1 hypothetical protein CP001918.1.gene5135. Protein 3e-27 41
lin1542 NP_470878.1 hypothetical protein AF130997.1.orf0.gene Protein 5e-27 41
lin1542 NP_470878.1 hypothetical protein CP000647.1.gene4257. Protein 3e-27 41
lin1542 NP_470878.1 hypothetical protein BAC0533 Protein 3e-27 41
lin1542 NP_470878.1 hypothetical protein CP004022.1.gene3215. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lin1542 NP_470878.1 hypothetical protein VFG1563 Protein 2e-32 48
lin1542 NP_470878.1 hypothetical protein VFG1702 Protein 3e-32 48
lin1542 NP_470878.1 hypothetical protein VFG1389 Protein 6e-27 42