Gene Information

Name : ramA
Accession : NP_455158.1
Strain : Salmonella enterica CT18
Genome accession: NC_003198
Putative virulence/resistance : Resistance
Product : transcriptional activator RamA
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 623134 - 623475 bp
Length : 342 bp
Strand : +
Note : Similar to Klebsiella pneumoniae transcriptional activator RamA ramA SW:RAMA_KLEPN (Q48413) (113 aa) fasta scores: E(): 0, 90.3% id in 113 aa, and to Escherichia coli regulatory protein SoxS soxS SW:SOXS_ECOLI (P22539) (106 aa) fasta scores: E(): 3e-18, 4

DNA sequence : 
ATGACCATTTCCGCTCAGGTTATCGACACGATTGTCGAGTGGATTGATGATAATTTGAATCAGCCGTTACGTATTGATGA
TATTGCCCGTCATGCGGGGTATTCCAAGTGGCACCTGCAGCGCCTTTTTATGCAGTACAAAGGGGAGAGTCTGAGGCGCT
ACGTGCGTGAACGGAAGCTAAAACTGGCGGCGCGCGACCTGCGCGACACCGACCAGAAGGTGTATGATATTTGTCTCAAG
TATGGTTTTGATTCGCAGCAAACCTTTACGCGCATTTTTACCCGCACGTTCAACCTGCCGCCAGGCGCTTATCGTAAAGA
AAAGCATGGCCGTACGCATTGA

Protein sequence : 
MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLRRYVRERKLKLAARDLRDTDQKVYDICLK
YGFDSQQTFTRIFTRTFNLPPGAYRKEKHGRTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-18 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-17 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-17 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA NP_455158.1 transcriptional activator RamA CP001138.1.gene612.p Protein 3e-43 99
ramA NP_455158.1 transcriptional activator RamA CP001918.1.gene327.p Protein 1e-18 48
ramA NP_455158.1 transcriptional activator RamA CP000647.1.gene4499. Protein 2e-18 48
ramA NP_455158.1 transcriptional activator RamA CP001138.1.gene4488. Protein 2e-18 48
ramA NP_455158.1 transcriptional activator RamA NC_010558.1.6276025. Protein 2e-17 47
ramA NP_455158.1 transcriptional activator RamA BAC0371 Protein 2e-17 45
ramA NP_455158.1 transcriptional activator RamA NC_002695.1.914293.p Protein 2e-17 45
ramA NP_455158.1 transcriptional activator RamA CP000647.1.gene1624. Protein 2e-17 45
ramA NP_455158.1 transcriptional activator RamA CP000034.1.gene4505. Protein 3e-17 44
ramA NP_455158.1 transcriptional activator RamA CP001918.1.gene2033. Protein 7e-18 44
ramA NP_455158.1 transcriptional activator RamA BAC0560 Protein 6e-18 42
ramA NP_455158.1 transcriptional activator RamA NC_002695.1.917339.p Protein 6e-18 42
ramA NP_455158.1 transcriptional activator RamA CP000034.1.gene1596. Protein 5e-18 42
ramA NP_455158.1 transcriptional activator RamA CP001138.1.gene1637. Protein 6e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA NP_455158.1 transcriptional activator RamA VFG0585 Protein 1e-18 48
ramA NP_455158.1 transcriptional activator RamA VFG1038 Protein 1e-17 47