
|
Name : ramA Accession : NP_455158.1 Strain : Salmonella enterica CT18 Genome accession: NC_003198 Putative virulence/resistance : Resistance Product : transcriptional activator RamA Function : - COG functional category : K : Transcription COG ID : COG4977 EC number : - Position : 623134 - 623475 bp Length : 342 bp Strand : + Note : Similar to Klebsiella pneumoniae transcriptional activator RamA ramA SW:RAMA_KLEPN (Q48413) (113 aa) fasta scores: E(): 0, 90.3% id in 113 aa, and to Escherichia coli regulatory protein SoxS soxS SW:SOXS_ECOLI (P22539) (106 aa) fasta scores: E(): 3e-18, 4 DNA sequence : ATGACCATTTCCGCTCAGGTTATCGACACGATTGTCGAGTGGATTGATGATAATTTGAATCAGCCGTTACGTATTGATGA TATTGCCCGTCATGCGGGGTATTCCAAGTGGCACCTGCAGCGCCTTTTTATGCAGTACAAAGGGGAGAGTCTGAGGCGCT ACGTGCGTGAACGGAAGCTAAAACTGGCGGCGCGCGACCTGCGCGACACCGACCAGAAGGTGTATGATATTTGTCTCAAG TATGGTTTTGATTCGCAGCAAACCTTTACGCGCATTTTTACCCGCACGTTCAACCTGCCGCCAGGCGCTTATCGTAAAGA AAAGCATGGCCGTACGCATTGA Protein sequence : MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLRRYVRERKLKLAARDLRDTDQKVYDICLK YGFDSQQTFTRIFTRTFNLPPGAYRKEKHGRTH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 5e-18 | 48 |
| tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 4e-17 | 47 |
| tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 4e-17 | 47 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ramA | NP_455158.1 | transcriptional activator RamA | CP001138.1.gene612.p | Protein | 3e-43 | 99 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP001918.1.gene327.p | Protein | 1e-18 | 48 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP000647.1.gene4499. | Protein | 2e-18 | 48 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP001138.1.gene4488. | Protein | 2e-18 | 48 |
| ramA | NP_455158.1 | transcriptional activator RamA | NC_010558.1.6276025. | Protein | 2e-17 | 47 |
| ramA | NP_455158.1 | transcriptional activator RamA | NC_002695.1.914293.p | Protein | 2e-17 | 45 |
| ramA | NP_455158.1 | transcriptional activator RamA | BAC0371 | Protein | 2e-17 | 45 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP000647.1.gene1624. | Protein | 2e-17 | 45 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP000034.1.gene4505. | Protein | 3e-17 | 44 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP001918.1.gene2033. | Protein | 7e-18 | 44 |
| ramA | NP_455158.1 | transcriptional activator RamA | BAC0560 | Protein | 6e-18 | 42 |
| ramA | NP_455158.1 | transcriptional activator RamA | NC_002695.1.917339.p | Protein | 6e-18 | 42 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP000034.1.gene1596. | Protein | 5e-18 | 42 |
| ramA | NP_455158.1 | transcriptional activator RamA | CP001138.1.gene1637. | Protein | 6e-18 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ramA | NP_455158.1 | transcriptional activator RamA | VFG0585 | Protein | 1e-18 | 48 |
| ramA | NP_455158.1 | transcriptional activator RamA | VFG1038 | Protein | 1e-17 | 47 |