|
Name : cII Accession : NP_458752.1 Strain : Salmonella enterica CT18 Genome accession: NC_003198 Putative virulence/resistance : Unknown Product : transcriptional regulatory protein Function : - COG functional category : K : Transcription COG ID : COG3423 EC number : - Position : 4537312 - 4537533 bp Length : 222 bp Strand : + Note : Similar to Bacteriophage Mu negative regulatory DNA-binding protein Ner or cII SW:DBNE_BPMU (P06020) (74 aa) fasta scores: E(): 1.2e-15, 66.2% id in 68 aa and to Escherichia coli ner-like protein Nlp SW:NLP_ECOLI (P18837) (92 aa) fasta scores: E(): 1.1e-1 DNA sequence : ATGACGCAACAGGACTGGCATCCCGCCGACATTATCGCGGGGTTGAGAAAACGGGGCACCTCGCTGGCGGCGCTGTCCCG TCAGTCGGGGCTGGCGTCCTCAACGCTGGCAAATGCGCTGATAAGGCACTGGCCCAAAGGCGAAAGGCTGATTGCCGAAG CGTTGGGTATTGCGCCAGAGCAAATCTGGCCTTCCCACTACCGCAAGCCTGAAAATTACTAA Protein sequence : MTQQDWHPADIIAGLRKRGTSLAALSRQSGLASSTLANALIRHWPKGERLIAEALGIAPEQIWPSHYRKPENY |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| cII | NP_458752.1 | transcriptional regulatory protein | Not tested | SPI-7 | Protein | 2e-28 | 100 |
| cII | NP_807957.1 | transcriptional regulator | Not tested | SPI-7 | Protein | 2e-28 | 100 |
| pln1 | AAO17222.1 | Pln1 | Not tested | tcd island | Protein | 6e-18 | 64 |
| unnamed | AAQ07472.1 | Ner-like protein | Not tested | Not named | Protein | 8e-17 | 64 |
