Gene Information

Name : STY4600
Accession : NP_458683.1
Strain : Salmonella enterica CT18
Genome accession: NC_003198
Putative virulence/resistance : Unknown
Product : putative positive regulator of late gene transcription
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4474437 - 4474655 bp
Length : 219 bp
Strand : -
Note : Similar to Escherichia coli prophage P2 Ogr protein SW:OGRK_ECOLI () (72 aa) fasta scores: E(): 4.8e-15, 55.7% id in 70 aa and to Bacteriophage 186 late gene control protein B SW:VPB_BP186 (P08711) (72 aa) fasta scores: E(): 2.1e-17, 64.2% id in 67 aa.

DNA sequence :
ATGATGAATTGTCCAAAGTGTGGACACTCAGCGCACACTAGGAGCAGCTTTCAGGTTACGGACAGCACAAAAGAGCGTTA
CTGCCAGTGCCAGAACATTAACTGTGGTAGCACCTTTGTCACCCATGAAACGGTAGTGCGCTTTATAGTTACGCCAGCAT
TGGTAAATAACGCTCCTCCACATCCAACAGTGAGTGGGCAAGGGCACATGAATTTTTAA

Protein sequence :
MMNCPKCGHSAHTRSSFQVTDSTKERYCQCQNINCGSTFVTHETVVRFIVTPALVNNAPPHPTVSGQGHMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
t4294 NP_807891.1 positive regulator of late gene transcription Not tested SPI-7 Protein 7e-29 100
STY4600 NP_458683.1 putative positive regulator of late gene transcription Not tested SPI-7 Protein 7e-29 100