Name : STY4600 Accession : NP_458683.1 Strain : Salmonella enterica CT18 Genome accession: NC_003198 Putative virulence/resistance : Unknown Product : putative positive regulator of late gene transcription Function : - COG functional category : - COG ID : - EC number : - Position : 4474437 - 4474655 bp Length : 219 bp Strand : - Note : Similar to Escherichia coli prophage P2 Ogr protein SW:OGRK_ECOLI () (72 aa) fasta scores: E(): 4.8e-15, 55.7% id in 70 aa and to Bacteriophage 186 late gene control protein B SW:VPB_BP186 (P08711) (72 aa) fasta scores: E(): 2.1e-17, 64.2% id in 67 aa. DNA sequence : ATGATGAATTGTCCAAAGTGTGGACACTCAGCGCACACTAGGAGCAGCTTTCAGGTTACGGACAGCACAAAAGAGCGTTA CTGCCAGTGCCAGAACATTAACTGTGGTAGCACCTTTGTCACCCATGAAACGGTAGTGCGCTTTATAGTTACGCCAGCAT TGGTAAATAACGCTCCTCCACATCCAACAGTGAGTGGGCAAGGGCACATGAATTTTTAA Protein sequence : MMNCPKCGHSAHTRSSFQVTDSTKERYCQCQNINCGSTFVTHETVVRFIVTPALVNNAPPHPTVSGQGHMNF |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
STY4600 | NP_458683.1 | putative positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 7e-29 | 100 |
t4294 | NP_807891.1 | positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 7e-29 | 100 |