Gene Information

Name : soxS
Accession : NP_458563.1
Strain : Salmonella enterica CT18
Genome accession: NC_003198
Putative virulence/resistance : Resistance
Product : regulatory protein SoxS
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4349095 - 4349418 bp
Length : 324 bp
Strand : -
Note : Orthologue of E. coli soxS (SOXS_ECOLI); Fasta hit to SOXS_ECOLI (106 aa), 94% identity in 106 aa overlap

DNA sequence :
ATGTCGCATCAGCAGATAATTCAGACCCTTATCGAATGGATTGATGAACATATCAACCAACCGCTAAACATTGATGTGGT
GGCAAAAAAATCGGGTTACTCCAAGTGGTATTTGCAGCGGATGTTTCGTACGGTAACGCATCAAACATTAGGCGAGTATA
TTCGCCAGCGCCGTCTCCTGTTAGCGGCCGTTGAGCTACGAACGACCGAGCGCCCGATTTTTGATATCGCGATGGACCTG
GGCTATGTATCGCAGCAAACCTTCTCGCGTGTATTCCGCCGCGAGTTCGATCGCACTCCCAGCGATTACCGTCACCGCCT
GTAG

Protein sequence :
MSHQQIIQTLIEWIDEHINQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-46 99
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-21 49
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-21 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS NP_458563.1 regulatory protein SoxS CP001138.1.gene4488. Protein 6e-47 99
soxS NP_458563.1 regulatory protein SoxS NC_002695.1.914293.p Protein 9e-46 95
soxS NP_458563.1 regulatory protein SoxS BAC0371 Protein 9e-46 95
soxS NP_458563.1 regulatory protein SoxS CP000034.1.gene4505. Protein 2e-45 94
soxS NP_458563.1 regulatory protein SoxS CP001918.1.gene327.p Protein 5e-45 94
soxS NP_458563.1 regulatory protein SoxS CP000647.1.gene4499. Protein 3e-44 90
soxS NP_458563.1 regulatory protein SoxS CP001138.1.gene612.p Protein 4e-25 50
soxS NP_458563.1 regulatory protein SoxS NC_010558.1.6276025. Protein 3e-21 49
soxS NP_458563.1 regulatory protein SoxS CP000647.1.gene1624. Protein 1e-19 43
soxS NP_458563.1 regulatory protein SoxS CP001918.1.gene2033. Protein 5e-20 43
soxS NP_458563.1 regulatory protein SoxS CP001138.1.gene1637. Protein 7e-20 42
soxS NP_458563.1 regulatory protein SoxS BAC0560 Protein 7e-20 42
soxS NP_458563.1 regulatory protein SoxS NC_002695.1.917339.p Protein 7e-20 42
soxS NP_458563.1 regulatory protein SoxS CP000034.1.gene1596. Protein 6e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS NP_458563.1 regulatory protein SoxS VFG0585 Protein 6e-47 99
soxS NP_458563.1 regulatory protein SoxS VFG1038 Protein 2e-21 49