Gene Information

Name : prgI
Accession : NP_457267.1
Strain : Salmonella enterica CT18
Genome accession: NC_003198
Putative virulence/resistance : Virulence
Product : pathogenicity 1 island effector protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2868089 - 2868331 bp
Length : 243 bp
Strand : -
Note : Similar to several proteins essential for protein secretion by a type III system: Salmonella typhimurium protein PrgI required for invasion of epithelial cells SW:PRGI_SALTY (P41784) (80 aa) fasta scores: E(): 4.2e-28, 95.0% id in 80 aa and Shigella flexn

DNA sequence :
ATGCCAACATCTTGGTCAGGCTATCTGGATGAAGTTTCAGCAAAATTTGATAAGGGCGTTGATAATCTACAAACGCAGGT
AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT
ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT
TAA

Protein sequence :
MPTSWSGYLDEVSAKFDKGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
prgI NP_457267.1 pathogenicity 1 island effector protein Virulence SPI-1 Protein 1e-30 100
prgI NP_806476.1 pathogenicity island 1 effector protein Virulence SPI-1 Protein 1e-30 100
prgI NP_461794.1 needle complex major subunit Virulence SPI-1 Protein 1e-29 95
prgI AAX49613.1 PrgI Virulence SPI-1 Protein 1e-29 95
prgI YP_217792.1 cell invasion protein Virulence SPI-1 Protein 1e-29 95
ECs3718 NP_311745.1 EprI Not tested LIM Protein 3e-20 62
ysaG AAS66835.1 YsaG Not tested SSR-1 Protein 2e-16 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prgI NP_457267.1 pathogenicity 1 island effector protein VFG0535 Protein 4e-30 95
prgI NP_457267.1 pathogenicity 1 island effector protein VFG0996 Protein 2e-19 69
prgI NP_457267.1 pathogenicity 1 island effector protein VFG2466 Protein 1e-17 56