Gene Information

Name : terD5 (SAV_7387)
Accession : NP_828563.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 8815160 - 8815735 bp
Length : 576 bp
Strand : +
Note : PF02342: Bacterial stress protein

DNA sequence :
GTGGGCGTAACTCTGGCCAAGGGCGGCAACGTTTCGCTGAGCAAAGAGGCTCCGGGCCTGACCGCGGTGACGGTGGGCCT
CGGGTGGGACGTGCGGACGACCACCGGTGCCGCATACGACCTGGACGCGAGTGCGCTGCTGTGTTCCGGCTCGGGCCGGG
TCGTCTCCGACCTGCACTTCGTCTTCTACAACAACCTGACGAGCCCGGACGGTTCGGTCCAGCACACCGGCGACAACCTG
ACCGGTGAGGGCGAGGGCGACGACGAGTCCATCAACGTCGAACTGGCCCAGGTGCCGGCCGAGGTCACCAAGATCGTCTT
CCCGGTCTCCATCCACGAGGCGCAGTCGCGCGGCCAGAGCTTCGGCCAGGTCAGCAACGCCTTCATCCGCGTGGTGAACC
GCGCCAACAATGTCGAACTCGCCCGCTACGACCTGTCCGAGGACGCCTCGACCGAGACGGCGATGGTCTTCGGCGAGCTC
TACCGGCACGGCGGCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGATACGCATCGGGCCTCGCGGGCATCGCGTCCGACTA
CGGCGTGAACGTCTGA

Protein sequence :
MGVTLAKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGAAYDLDASALLCSGSGRVVSDLHFVFYNNLTSPDGSVQHTGDNL
TGEGEGDDESINVELAQVPAEVTKIVFPVSIHEAQSRGQSFGQVSNAFIRVVNRANNVELARYDLSEDASTETAMVFGEL
YRHGGEWKFRAVGQGYASGLAGIASDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-61 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-61 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-61 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-61 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-58 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-31 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD5 NP_828563.1 tellurium resistance protein BAC0390 Protein 2e-62 66
terD5 NP_828563.1 tellurium resistance protein BAC0389 Protein 3e-60 66
terD5 NP_828563.1 tellurium resistance protein BAC0392 Protein 5e-27 42