Gene Information

Name : terD3 (SAV_5803)
Accession : NP_826980.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7009081 - 7009656 bp
Length : 576 bp
Strand : +
Note : PF02342: Bacterial stress protein

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTATCGCTGACCAAGGAGGCGCCCGGCCTGACCGCGGTCATCGTGGGCCT
GGGATGGGACGTCCGTACCACCACGGGTACCGACTTCGACCTCGACGCCAGCGCGCTGCTGACGAACGTGGAGGGCAAGG
TCGCCAACGACCAGAACTTCGTGTTCTTCAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGCGACAACATC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGGTCGACCTCGCGACGGTCCCGGCCGACGTCGACAAGATCGTCTT
CCCGGTGTCGATCTATGACGCCGAGAACCGCCAGCAGTCCTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTGGTGAACC
AGGCAGGTGGCGCGGAAATCGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCCCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCCTCGGGCCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVIVGLGWDVRTTTGTDFDLDASALLTNVEGKVANDQNFVFFNNLKSPDGSVEHTGDNI
TGEGEGDDEQIKVDLATVPADVDKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRNGPEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-64 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-58 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-60 65
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-31 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-28 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD3 NP_826980.1 tellurium resistance protein BAC0389 Protein 9e-61 65
terD3 NP_826980.1 tellurium resistance protein BAC0390 Protein 2e-60 64
terD3 NP_826980.1 tellurium resistance protein BAC0392 Protein 1e-27 42