Gene Information

Name : SAV_5063 (SAV_5063)
Accession : NP_826240.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6136558 - 6137247 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGATGTCGTTTATGAAGGGACGAGTCCTTGTCGTCGATGACGACACCGCACTGGCCGAGATGCTCGGCATTGTGTTGCG
TGGTGAAGGTTTTGAGCCGTCTTTTGTAGCCGACGGCGACAAGGCGCTGGCCGCTTTCCGTGAGTCCAAGCCCGATCTTG
TGCTCCTGGACCTGATGCTGCCCGGCCGGGACGGTATCGAGGTGTGCCGCCTGATCAGGGCGGAGTCCGGGGTGCCGATC
GTGATGCTCACGGCCAAGAGCGACACCGTCGATGTCGTGGTGGGCCTGGAGTCGGGCGCGGACGACTACATCGTGAAGCC
GTTCAAGCCAAAGGAGCTGGTGGCCCGTATCCGGGCGCGGCTGCGGAGGTCCGAGGAGCCGGCGCCCGAGCAGCTCGGCA
TAGGTGACCTGGTCATCGATGTGGCGGGTCACTCCGTGAAGCGGGACGGGCAGTCGATCGCGCTGACGCCGCTGGAGTTC
GATCTGCTGGTGGCGCTGGCCCGCAAGCCGTGGCAGGTGTTCACGCGTGAGGTCCTGCTCGAGCAGGTCTGGGGCTACCG
GCACGCGGCGGACACCCGCCTGGTCAACGTGCATGTACAGCGGCTGCGCTCCAAAGTCGAGAAGGACCCGGAGCGGCCGG
AGATCGTGGTGACCGTCCGTGGCGTCGGTTACAAGGCCGGACCGAGCTGA

Protein sequence :
MMSFMKGRVLVVDDDTALAEMLGIVLRGEGFEPSFVADGDKALAAFRESKPDLVLLDLMLPGRDGIEVCRLIRAESGVPI
VMLTAKSDTVDVVVGLESGADDYIVKPFKPKELVARIRARLRRSEEPAPEQLGIGDLVIDVAGHSVKRDGQSIALTPLEF
DLLVALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPERPEIVVTVRGVGYKAGPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAV_5063 NP_826240.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-80 75
SAV_5063 NP_826240.1 two-component system response regulator BAC0125 Protein 9e-34 46
SAV_5063 NP_826240.1 two-component system response regulator NC_012469.1.7685629. Protein 5e-45 46
SAV_5063 NP_826240.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-45 45
SAV_5063 NP_826240.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-46 45
SAV_5063 NP_826240.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-41 45
SAV_5063 NP_826240.1 two-component system response regulator NC_012469.1.7686381. Protein 7e-42 44
SAV_5063 NP_826240.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator AE015929.1.gene1106. Protein 5e-36 43
SAV_5063 NP_826240.1 two-component system response regulator BAC0596 Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator CP001138.1.gene2239. Protein 3e-40 43
SAV_5063 NP_826240.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-34 42
SAV_5063 NP_826240.1 two-component system response regulator AE016830.1.gene1681. Protein 8e-41 42
SAV_5063 NP_826240.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-40 42
SAV_5063 NP_826240.1 two-component system response regulator BAC0039 Protein 2e-40 42
SAV_5063 NP_826240.1 two-component system response regulator CP001918.1.gene3444. Protein 2e-39 42
SAV_5063 NP_826240.1 two-component system response regulator CP000034.1.gene2186. Protein 2e-40 42
SAV_5063 NP_826240.1 two-component system response regulator AF155139.2.orf0.gene Protein 3e-35 41
SAV_5063 NP_826240.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-36 41
SAV_5063 NP_826240.1 two-component system response regulator BAC0197 Protein 8e-32 41
SAV_5063 NP_826240.1 two-component system response regulator CP000647.1.gene2531. Protein 6e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAV_5063 NP_826240.1 two-component system response regulator VFG1389 Protein 8e-32 44
SAV_5063 NP_826240.1 two-component system response regulator VFG1390 Protein 2e-35 43
SAV_5063 NP_826240.1 two-component system response regulator VFG1702 Protein 1e-37 41