Gene Information

Name : SAV_4416 (SAV_4416)
Accession : NP_825593.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5400539 - 5401288 bp
Length : 750 bp
Strand : +
Note : -

DNA sequence :
ATGCAGCAGCCGTACGAATTCCGGGGGGCCGAGGCGGTGGAGCGGGGCGCCGGAGCCGGAGCCCGCGTGCTCGTCGTCGA
CGACGACCCCACCGTCGCCGAGGTCGTCTCCGGCTACCTCGACCGCGCCGGGTACGTCGTGGACCGGGCCGAGGACGGCC
CCACCGCGCTCGCCCGCGCCGCGGCGCACTGGCCCGACCTGGTGGTGCTGGACCTGATGCTGCCCGGGATGGACGGCCTG
GAGGTGTGCCGGCGGATGCGCGGCCGCGGGCCCGTGCCGGTCATCATGCTCACCGCCCGCGGCGACGAGGACGACCGCAT
CCTCGGGCTCGAGGTGGGCGCCGACGACTACGTCACCAAGCCCTTCAGCCCGCGGGAGCTGGTCCTGCGGGTGGAGTCCG
TCCTGCGCCGCACCCGGCCCGTCACCGCCCCGCGCCCCCTGCACGCGTCCGGTCTCGCCCTCGACCCCGCGGCCCGCCGC
GCCACCAAGGACGGCGAGGAACTCGCCCTGACCATCCGTGAGTTCGACCTCCTCGCCTTCTTTCTCCGCCATCCCGGCCG
GGCGTTCAGCCGCGAGGACCTGATGCGCGAGGTGTGGGGCTGGGACTTCGGCGACCTGTCGACGGTCACCGTCCACGTAC
GCCGGCTCCGGGGCAAGGTCGAGGACGACCCGGCGAGACCCCGTCTGATCCAGACGGTGTGGGGCGTCGGATACCGCTTC
GGCACCACGCCCCGCCAGGAGGCGGTCTGA

Protein sequence :
MQQPYEFRGAEAVERGAGAGARVLVVDDDPTVAEVVSGYLDRAGYVVDRAEDGPTALARAAAHWPDLVVLDLMLPGMDGL
EVCRRMRGRGPVPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRTRPVTAPRPLHASGLALDPAARR
ATKDGEELALTIREFDLLAFFLRHPGRAFSREDLMREVWGWDFGDLSTVTVHVRRLRGKVEDDPARPRLIQTVWGVGYRF
GTTPRQEAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-39 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAV_4416 NP_825593.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-45 48
SAV_4416 NP_825593.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-40 47
SAV_4416 NP_825593.1 two-component system response regulator BAC0197 Protein 3e-33 44
SAV_4416 NP_825593.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-43 43
SAV_4416 NP_825593.1 two-component system response regulator CP000034.1.gene3671. Protein 7e-40 43
SAV_4416 NP_825593.1 two-component system response regulator BAC0347 Protein 1e-34 42
SAV_4416 NP_825593.1 two-component system response regulator NC_011595.7057856.p0 Protein 2e-38 42
SAV_4416 NP_825593.1 two-component system response regulator NC_010410.6002989.p0 Protein 2e-38 42
SAV_4416 NP_825593.1 two-component system response regulator NC_010400.5986590.p0 Protein 1e-38 42
SAV_4416 NP_825593.1 two-component system response regulator CP000647.1.gene2531. Protein 3e-35 42
SAV_4416 NP_825593.1 two-component system response regulator BAC0083 Protein 1e-35 41
SAV_4416 NP_825593.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-42 41
SAV_4416 NP_825593.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-41 41
SAV_4416 NP_825593.1 two-component system response regulator BAC0125 Protein 2e-32 41
SAV_4416 NP_825593.1 two-component system response regulator BAC0596 Protein 4e-34 41
SAV_4416 NP_825593.1 two-component system response regulator BAC0039 Protein 3e-34 41
SAV_4416 NP_825593.1 two-component system response regulator CP001918.1.gene3444. Protein 2e-34 41
SAV_4416 NP_825593.1 two-component system response regulator CP001138.1.gene2239. Protein 4e-34 41
SAV_4416 NP_825593.1 two-component system response regulator CP000034.1.gene2186. Protein 3e-34 41
SAV_4416 NP_825593.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAV_4416 NP_825593.1 two-component system response regulator VFG1390 Protein 4e-37 44
SAV_4416 NP_825593.1 two-component system response regulator VFG0596 Protein 5e-30 44
SAV_4416 NP_825593.1 two-component system response regulator VFG1563 Protein 7e-40 43
SAV_4416 NP_825593.1 two-component system response regulator VFG1389 Protein 2e-31 43
SAV_4416 NP_825593.1 two-component system response regulator VFG1702 Protein 5e-39 42
SAV_4416 NP_825593.1 two-component system response regulator VFG1386 Protein 2e-31 41