Gene Information

Name : phoP (SAV_3972)
Accession : NP_825149.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4898071 - 4898742 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
GTGCTCGTCGTCGAGGACGAGGAGTCCTTCAGCGACGCCCTGTCCTACATGCTTCGCAAGGAGGGCTTCGAGGTCGCCAT
CGCGACCACCGGCCCCGACGGTCTGGACGAGTTCGAGCGCAACGGCGCCGACCTCGTGCTGCTCGACCTGATGCTGCCCG
GTCTGCCGGGCACGGAGGTCTGCCGTCAGCTGCGTGGCCGCTCCAACGTGCCGGTGATCATGGTCACCGCCAAGGACAGC
GAGATCGACAAGGTCGTCGGGCTGGAGATAGGAGCCGACGACTACGTCACCAAGCCCTTCTCCTCCCGCGAACTGGTCGC
CCGCATCCGGGCCGTCCTGCGCCGCCGCGGGGAGCCCGAGGAGGTCACCCCGGCCGCCCTGGAGGCAGGTCCGGTGCGCA
TGGACGTCGACCGCCACGTGGTCACCGTCTCCGGCTCCAAGGTCGACCTTCCCCTGAAGGAGTTCGACCTCCTGGAGATG
CTGCTGCGCAACGCGGGCCGCGTCCTGACCCGCATGCAGCTCATCGACCGGGTGTGGGGCGCCGACTACGTCGGTGACAC
CAAGACCCTGGACGTCCACGTGAAGCGCCTGCGCGCGAAGATCGAGCCGGACCCGGGCGCGCCGCGGTACCTGGTGACGG
TGCGTGGTCTCGGCTACAAGTTCGAGCCGTAG

Protein sequence :
MLVVEDEESFSDALSYMLRKEGFEVAIATTGPDGLDEFERNGADLVLLDLMLPGLPGTEVCRQLRGRSNVPVIMVTAKDS
EIDKVVGLEIGADDYVTKPFSSRELVARIRAVLRRRGEPEEVTPAALEAGPVRMDVDRHVVTVSGSKVDLPLKEFDLLEM
LLRNAGRVLTRMQLIDRVWGADYVGDTKTLDVHVKRLRAKIEPDPGAPRYLVTVRGLGYKFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP NP_825149.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-32 48
phoP NP_825149.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-31 47
phoP NP_825149.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_009641.5332272.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_013450.8614421.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_007793.3914279.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_002758.1121668.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_003923.1003749.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_009782.5559369.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_002951.3237708.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_002745.1124361.p0 Protein 4e-32 45
phoP NP_825149.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-36 45
phoP NP_825149.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-19 42
phoP NP_825149.1 two-component system response regulator BAC0083 Protein 5e-24 42
phoP NP_825149.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-34 42
phoP NP_825149.1 two-component system response regulator BAC0347 Protein 3e-17 42
phoP NP_825149.1 two-component system response regulator BAC0125 Protein 1e-22 41
phoP NP_825149.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-25 41
phoP NP_825149.1 two-component system response regulator BAC0638 Protein 2e-13 41
phoP NP_825149.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP NP_825149.1 two-component system response regulator VFG1389 Protein 5e-23 44
phoP NP_825149.1 two-component system response regulator VFG1386 Protein 5e-20 43
phoP NP_825149.1 two-component system response regulator VFG1390 Protein 4e-26 41
phoP NP_825149.1 two-component system response regulator VFG0596 Protein 2e-19 41