Gene Information

Name : terD2 (SAV_3947)
Accession : NP_825124.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4871772 - 4872347 bp
Length : 576 bp
Strand : +
Note : PF02342: Bacterial stress protein

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGCCGTCACCGTGGGCCT
CGGCTGGGACGTCCGCACCACCACGGGTACCGACTTCGACCTCGACGCCTCGGCCATCGCGGTCAACCCCACGGGCAAGG
TCTACTCGGACGCCCACTTCGTCTTCTTCAACAACAAGCAGACCCCGGACCAGACCATCGTTCACACCGGCGACAACCGC
ACGGGCGAGGGCGCGGGCGACGACGAGGCGATCAACGTCAACCTGGCGGGCCTCCCCGCCGACGTCGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCTCGCAGAACTTCGGCCAGGTCCGCAACGCGTACATCCGCATCGTCAACC
AGGCCGGCGGCGCGGAGATCGCCCGCTACGACCTGTCGGAGGACGCGGCGACGGAGACGGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCGGGCCTGGTGGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNPTGKVYSDAHFVFFNNKQTPDQTIVHTGDNR
TGEGAGDDEAINVNLAGLPADVDKIVFPVSIYDAENRSQNFGQVRNAYIRIVNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-58 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-58 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD2 NP_825124.1 tellurium resistance protein BAC0390 Protein 6e-59 62
terD2 NP_825124.1 tellurium resistance protein BAC0389 Protein 8e-58 60