Gene Information

Name : arsR (SAP016)
Accession : NP_395552.1
Strain :
Genome accession: NC_003140
Putative virulence/resistance : Resistance
Product : arsenical resistance operon repressor
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 14107 - 14421 bp
Length : 315 bp
Strand : +
Note : Staphylococcus aureus plasmid pI258 resistance operon repressor - Staphylococcus aureus plasmid pI258

DNA sequence : 
ATGTCTTATAAAGAACTATCAACAATATTAAAAATTTTATCAGATCCAAGTAGGTTAGAAATATTAGATTTACTTTCTTG
TGGTGAGCTATGCGCTTGTGACTTATTAGAACACTTTCAATTCTCACAACCTACACTAAGTCATCATATGAAGTCATTAG
TAGATAATGAATTAGTTACAACACGAAAAGATGGCAATAAACATTGGTATCAACTTAATCATGCTATTTTAGATGATATT
ATCCAAAACTTGAACATCATTAATACATCTAATCAAAGATGTGTATGTAAAAATGTGAAATCAGGTGACTGTTGA

Protein sequence : 
MSYKELSTILKILSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWYQLNHAILDDI
IQNLNIINTSNQRCVCKNVKSGDC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR YP_005754066.1 arsenical resistance operon repressor Not tested Type-XI SCCmec Protein 1e-31 80
arsR YP_252018.1 arsenical resistance operon repressor Not tested SCCmec Protein 7e-30 74
arsR YP_252025.1 arsenical resistance operon repressor Not tested SCCmec Protein 4e-27 66

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsR NP_395552.1 arsenical resistance operon repressor BAC0590 Protein 1e-36 99
arsR NP_395552.1 arsenical resistance operon repressor BAC0592 Protein 2e-33 88