|
Name : NMA2091 (NMA2091) Accession : YP_002343346.1 Strain : Neisseria meningitidis Z2491 Genome accession: NC_003116 Putative virulence/resistance : Resistance Product : integral membrane drug resistance protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2044102 - 2044437 bp Length : 336 bp Strand : + Note : NMA2091, integral membrane drug resistance protein, len: 111aa; strongly similar to many drug resistance proteins eg. SW:P14319 (EBR_STAAU) ethidium bromide resistance protein from Staphylococcus aureus (107 aa) fasta scores; E(): 2.5e-17, 53.5% identity DNA sequence : ATGCAAATGCACTGGCTCTTTCTGACTGTAGCAATTTTAAGCGAAGTCTGCGGTTCTTCCATGCTCAAACTGAGTGGCGG GTTTAGCAAACTGTGGCCTTCTATTGGCGTGATAGTCAGCTTTTCGGTGTGTTTTTGGGCCTTGTCTATGACACTGAAAA CCATGCCGCTGGCTACAGCATACGCCATTTGGGCAGGCGTGGGACTGGTTTTAACGGCTTTAGTCAGCGTGGTGTTTTTC GGTGAGAAAGCTGATTTCATTGGGATTGTCAGCATCGGTTTGATTTTGCTGGGCGTGGTGCTGCTCAATACCATGTCGCA TATGTCGGGGCATTGA Protein sequence : MQMHWLFLTVAILSEVCGSSMLKLSGGFSKLWPSIGVIVSFSVCFWALSMTLKTMPLATAYAIWAGVGLVLTALVSVVFF GEKADFIGIVSIGLILLGVVLLNTMSHMSGH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-11 | 45 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-11 | 45 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-11 | 45 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 1e-11 | 45 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-11 | 45 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-11 | 45 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 1e-11 | 45 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 1e-11 | 45 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 1e-11 | 45 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-11 | 45 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-11 | 45 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-11 | 45 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-11 | 45 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-11 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0326 | Protein | 2e-17 | 55 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0329 | Protein | 2e-16 | 54 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0327 | Protein | 9e-20 | 52 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0321 | Protein | 2e-17 | 51 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0325 | Protein | 4e-19 | 51 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0139 | Protein | 6e-11 | 49 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | NC_002695.1.913273.p | Protein | 4e-16 | 49 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0150 | Protein | 4e-16 | 49 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0377 | Protein | 6e-18 | 48 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | CP004022.1.gene1549. | Protein | 6e-16 | 46 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0324 | Protein | 2e-14 | 46 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0322 | Protein | 1e-12 | 45 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0323 | Protein | 4e-12 | 45 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | BAC0002 | Protein | 7e-12 | 44 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | NC_010410.6003348.p0 | Protein | 7e-12 | 44 |
| NMA2091 | YP_002343346.1 | integral membrane drug resistance protein | CP001138.1.gene1489. | Protein | 6e-13 | 44 |
