Gene Information

Name : NMA2091 (NMA2091)
Accession : YP_002343346.1
Strain : Neisseria meningitidis Z2491
Genome accession: NC_003116
Putative virulence/resistance : Resistance
Product : integral membrane drug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2044102 - 2044437 bp
Length : 336 bp
Strand : +
Note : NMA2091, integral membrane drug resistance protein, len: 111aa; strongly similar to many drug resistance proteins eg. SW:P14319 (EBR_STAAU) ethidium bromide resistance protein from Staphylococcus aureus (107 aa) fasta scores; E(): 2.5e-17, 53.5% identity

DNA sequence :
ATGCAAATGCACTGGCTCTTTCTGACTGTAGCAATTTTAAGCGAAGTCTGCGGTTCTTCCATGCTCAAACTGAGTGGCGG
GTTTAGCAAACTGTGGCCTTCTATTGGCGTGATAGTCAGCTTTTCGGTGTGTTTTTGGGCCTTGTCTATGACACTGAAAA
CCATGCCGCTGGCTACAGCATACGCCATTTGGGCAGGCGTGGGACTGGTTTTAACGGCTTTAGTCAGCGTGGTGTTTTTC
GGTGAGAAAGCTGATTTCATTGGGATTGTCAGCATCGGTTTGATTTTGCTGGGCGTGGTGCTGCTCAATACCATGTCGCA
TATGTCGGGGCATTGA

Protein sequence :
MQMHWLFLTVAILSEVCGSSMLKLSGGFSKLWPSIGVIVSFSVCFWALSMTLKTMPLATAYAIWAGVGLVLTALVSVVFF
GEKADFIGIVSIGLILLGVVLLNTMSHMSGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 45
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 45
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 45
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-11 45
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-11 45
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-11 45
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-11 45
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 45
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-11 45
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 45
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-11 45
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 45
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-11 45
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-11 45
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 45
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-11 45
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-11 45
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-11 45
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-11 45
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0326 Protein 2e-17 55
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0329 Protein 2e-16 54
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0327 Protein 9e-20 52
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0321 Protein 2e-17 51
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0325 Protein 4e-19 51
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0139 Protein 6e-11 49
NMA2091 YP_002343346.1 integral membrane drug resistance protein NC_002695.1.913273.p Protein 4e-16 49
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0150 Protein 4e-16 49
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0377 Protein 6e-18 48
NMA2091 YP_002343346.1 integral membrane drug resistance protein CP004022.1.gene1549. Protein 6e-16 46
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0324 Protein 2e-14 46
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0322 Protein 1e-12 45
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0323 Protein 4e-12 45
NMA2091 YP_002343346.1 integral membrane drug resistance protein NC_010410.6003348.p0 Protein 7e-12 44
NMA2091 YP_002343346.1 integral membrane drug resistance protein BAC0002 Protein 7e-12 44
NMA2091 YP_002343346.1 integral membrane drug resistance protein CP001138.1.gene1489. Protein 6e-13 44