Gene Information

Name : rr02 (spr1107)
Accession : NP_358700.1
Strain : Streptococcus pneumoniae R6
Genome accession: NC_003098
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1107604 - 1108359 bp
Length : 756 bp
Strand : -
Note : -

DNA sequence :
TTGTGTCTTCTGACTATTTTTTGGTATAATAGTAGAGAAAAAGGTGAACATATGAAAAAAATACTAATTGTAGATGATGA
GAAACCAATCTCGGATATTATCAAGTTTAATATGACCAAGGAAGGTTATGAAGTTGTAACTGCTTTTAATGGTCGTGAAG
CGCTAGAGCAATTTGAAGCAGAGCAACCAGATATTATTATTCTGGATTTGATGCTTCCAGAAATTGATGGTTTAGAAGTT
GCTAAGACCATTCGTAAGACAAGCAGTGTGCCCATTCTTATGCTTTCAGCCAAAGATAGTGAATTTGATAAGGTTATCGG
TTTGGAACTTGGGGCAGATGACTATGTAACGAAACCCTTCTCCAATCGTGAGTTGCAGGCGCGTGTTAAAGCTCTTCTGC
GTCGTTCTCAACCTATGCCAGTAGATGGTCAGGAAGCAGATAGTAAACCTCAACCTATCCAAATTGGGGATTTAGAAATT
GTTCCAGACGCCTACGTGGCTAAAAAATATGGCGAAGAACTAGACTTAACCCATCGTGAATTTGAGCTTTTGTATCATTT
AGCATCGCATACAGGTCAAGTCATCACGCGCGAACACTTGCTTGAGACTGTCTGGGGTTATGACTATTTTGGTGATGTCC
GCACAGTTGATGTGACTGTACGACGTCTGCGTGAGAAGATTGAAGATACGCCCAGCCGACCAGAGTATATCTTGACGCGC
CGTGGTGTAGGGTATTACATGAGAAATAATGCTTGA

Protein sequence :
MCLLTIFWYNSREKGEHMKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEV
AKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQPMPVDGQEADSKPQPIQIGDLEI
VPDAYVAKKYGEELDLTHREFELLYHLASHTGQVITREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTR
RGVGYYMRNNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr02 NP_358700.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-100 100
rr02 NP_358700.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 2e-51 56
rr02 NP_358700.1 DNA-binding response regulator HE999704.1.gene2815. Protein 5e-50 54
rr02 NP_358700.1 DNA-binding response regulator NC_012469.1.7686381. Protein 7e-41 48
rr02 NP_358700.1 DNA-binding response regulator AE016830.1.gene1681. Protein 2e-44 47
rr02 NP_358700.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 1e-39 45
rr02 NP_358700.1 DNA-binding response regulator CP004022.1.gene3215. Protein 9e-33 44
rr02 NP_358700.1 DNA-binding response regulator HE999704.1.gene1528. Protein 7e-32 43
rr02 NP_358700.1 DNA-binding response regulator AM180355.1.gene1830. Protein 4e-36 43
rr02 NP_358700.1 DNA-binding response regulator NC_002695.1.915041.p Protein 2e-30 43
rr02 NP_358700.1 DNA-binding response regulator CP000034.1.gene3834. Protein 2e-30 43
rr02 NP_358700.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 1e-32 42
rr02 NP_358700.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 4e-37 42
rr02 NP_358700.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 1e-34 42
rr02 NP_358700.1 DNA-binding response regulator AE000516.2.gene3505. Protein 9e-33 42
rr02 NP_358700.1 DNA-binding response regulator CP001138.1.gene4273. Protein 2e-30 42
rr02 NP_358700.1 DNA-binding response regulator BAC0533 Protein 2e-30 42
rr02 NP_358700.1 DNA-binding response regulator CP000647.1.gene4257. Protein 2e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr02 NP_358700.1 DNA-binding response regulator VFG1389 Protein 1e-30 45
rr02 NP_358700.1 DNA-binding response regulator VFG1563 Protein 2e-33 42
rr02 NP_358700.1 DNA-binding response regulator VFG1702 Protein 2e-33 42