Gene Information

Name : phoB (Atu0425)
Accession : NP_353454.1
Strain :
Genome accession: NC_003062
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 422089 - 422772 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence : 
ATGGTGCCGAAGATTGCAGTTGTGGAAGACGAGGAAGCGCTGAGCGTCCTGCTTCGTTACAATCTCGAGGCTGAGGGATA
CGACGTCGACACGATACCCCGTGGCGACGAGGCGGAAATCAGGTTGCAGGAGCGTATTCCGGATCTTCTCATCCTGGACT
GGATGCTGCCTGGCGTCTCCGGCATCGAACTTTGCCGGAGGCTCAGAATGCGGCCGGAAACGGAACGCCTGCCCATCATC
ATGCTGACGGCGCGTGGCGAAGAGAGCGAGCGCGTTCGTGGCCTTGCCACCGGCGCCGACGATTATGTCGTCAAGCCGTT
CTCGACGCCGGAACTCATGGCCCGCGTCAAGGCCATGCTGCGCCGGGCGCGTCCCGAGGTTCTGTCTTCGGTGCTGAAAT
GTGGTGATATCGAACTGGATCGCGAGACCCATCGCGTTCACCGCAAAAGCCGCGAAGTGCGCCTCGGCCCGACGGAATTC
CGCCTGCTGGAGTTCCTGATGACCTCGCCGGGCCGGGTGTTCTCCCGCTCGCAATTGCTGGATGGCGTCTGGGGCCACGA
TATCTACGTCGACGAGCGTACCGTTGACGTGCATGTCGGACGCCTGCGCAAGGCGCTCAATTTCTCCCATATGCAGGATG
TCATCCGCACCGTGCGTGGTGCCGGATATTCGATGGAAGCCTGA

Protein sequence : 
MVPKIAVVEDEEALSVLLRYNLEAEGYDVDTIPRGDEAEIRLQERIPDLLILDWMLPGVSGIELCRRLRMRPETERLPII
MLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEF
RLLEFLMTSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSHMQDVIRTVRGAGYSMEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-34 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB NP_353454.1 two component response regulator AE000516.2.gene3505. Protein 3e-33 44
phoB NP_353454.1 two component response regulator NC_002952.2859905.p0 Protein 8e-41 42
phoB NP_353454.1 two component response regulator NC_002745.1124361.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_009782.5559369.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_002951.3237708.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_007622.3794472.p0 Protein 8e-41 42
phoB NP_353454.1 two component response regulator NC_002758.1121668.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_009641.5332272.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_013450.8614421.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_007793.3914279.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator NC_003923.1003749.p0 Protein 1e-40 42
phoB NP_353454.1 two component response regulator HE999704.1.gene2815. Protein 4e-39 42
phoB NP_353454.1 two component response regulator CP001918.1.gene3444. Protein 2e-33 42
phoB NP_353454.1 two component response regulator NC_010400.5986590.p0 Protein 5e-34 41
phoB NP_353454.1 two component response regulator NC_011595.7057856.p0 Protein 6e-35 41
phoB NP_353454.1 two component response regulator NC_010410.6002989.p0 Protein 6e-35 41
phoB NP_353454.1 two component response regulator NC_012469.1.7685629. Protein 3e-35 41
phoB NP_353454.1 two component response regulator CP001138.1.gene2239. Protein 1e-31 41
phoB NP_353454.1 two component response regulator CP000034.1.gene2186. Protein 1e-32 41
phoB NP_353454.1 two component response regulator NC_002695.1.916589.p Protein 1e-32 41
phoB NP_353454.1 two component response regulator BAC0596 Protein 1e-31 41
phoB NP_353454.1 two component response regulator BAC0039 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB NP_353454.1 two component response regulator VFG1390 Protein 3e-36 43
phoB NP_353454.1 two component response regulator VFG1563 Protein 2e-34 43
phoB NP_353454.1 two component response regulator VFG1702 Protein 2e-34 43