Gene Information

Name : MCA0676 (MCA0676)
Accession : YP_113189.1
Strain : Methylococcus capsulatus Bath
Genome accession: NC_002977
Putative virulence/resistance : Unknown
Product : phage integrase site specific recombinase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 709251 - 710162 bp
Length : 912 bp
Strand : +
Note : -

DNA sequence :
ATGGCACTTACAGACACCGCCGTCCGCAGCGCCAGGCCCGCCGAGAAAGCCTTCAAGCTGGCGGATGAGAAAGGCCTGTT
CCTTCACGTCATGCCAGGCGGCGCGCGATACTGGCGGCTCAAGTACCGGATCGGAGGCAAGGAGAAGCTGATGGCCTTGG
GCGTCTATCCCGAGGTCAGTTTGAAGGAGGCCCGCGCCCGCCGCGACAAGGCGCGCGCGCTGCTGGGCCAGGGCATCGAC
CCGAACGACCACAAGAAAGCCGCCAAGCGCACCGAGGCGGGTGAGGACAGCTTCGAGCGCATCGCCCTGGAGTGGCACGC
CCGCCACATGGCGAACAAGTCAGAGAGCCACGCCACGAAGACCCTGGAGCGTCTGCGGAAGGATGTGTTCCCCTGGATAG
GCAACAGGCCCGTCCGCGAGATCACCGCCCCCGAACTGCTGTCCGTGCTCCGGCGTATCGAGTCCCGCGGCGCCATCGAG
CTGTGCCACGTCACGAAACGAATCTGCGGCCAGGTGATGCGCTACGCCATCGCTACCGGTAGGGCCGAACGCGACCCGGC
CGCCGATCTGAAAGGCGCCCTACAACCGGTGAAAGCCAGGCACTTCGCGGCGATCACCGACCCCAAAGCCATCGGCGAGC
TGCTGCGGGCCATCGAGGAATATACAGGGCACTTCGCCACGCAATGCGCCTTGAAACTCTCGCCGCTGGTCATGCTGCGC
CCGGGCGAGGTCCGGCAAGCCGAGTGGGCGGAGATCGACATCGAGGCGGCCGAGTGGCGCATACCGGCCGCCAAAATGAA
GATGCGGGACGAGCACATCGTGCCCTTGTCACGCCAGGCTGTCGAAATCCTGGAATCCATCCGCCCGCTGACCGGCCGAG
GCCGCTATGCGTCCCCGGGGTTTCCTACCTAA

Protein sequence :
MALTDTAVRSARPAEKAFKLADEKGLFLHVMPGGARYWRLKYRIGGKEKLMALGVYPEVSLKEARARRDKARALLGQGID
PNDHKKAAKRTEAGEDSFERIALEWHARHMANKSESHATKTLERLRKDVFPWIGNRPVREITAPELLSVLRRIESRGAIE
LCHVTKRICGQVMRYAIATGRAERDPAADLKGALQPVKARHFAAITDPKAIGELLRAIEEYTGHFATQCALKLSPLVMLR
PGEVRQAEWAEIDIEAAEWRIPAAKMKMRDEHIVPLSRQAVEILESIRPLTGRGRYASPGFPT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 1e-55 48
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 8e-50 46
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 9e-47 46
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 1e-46 46
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-46 46
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-46 46
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 4e-46 46
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-46 46
int AAK16198.1 Int Not tested PAI-I AL862 Protein 1e-46 46
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 1e-46 46
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-46 46
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-46 46
int AAL51003.1 CP4-like integrase Not tested LEE Protein 9e-47 46
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-47 46
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-46 46
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-45 45
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 2e-46 45
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 2e-46 45
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 2e-46 45
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 8e-46 45
int CAC81896.1 integrase Not tested LEE II Protein 3e-38 45
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 6e-46 44
int AAK00456.1 Int Not tested SHI-1 Protein 5e-38 44
int CAC39282.1 integrase Not tested LPA Protein 4e-49 43
aec33 AAW51716.1 Int Not tested AGI-3 Protein 2e-49 43
int AAC31482.1 CP4-like integrase Not tested LEE Protein 3e-47 42
int ACU09430.1 integrase Not tested LEE Protein 3e-47 42
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 4e-47 42
ECs4534 NP_312561.1 integrase Not tested LEE Protein 4e-47 42
int AAD44730.1 Int Not tested SHI-2 Protein 3e-48 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 9e-47 41
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 7e-47 41
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 9e-47 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCA0676 YP_113189.1 phage integrase site specific recombinase VFG1693 Protein 2e-46 46
MCA0676 YP_113189.1 phage integrase site specific recombinase VFG0626 Protein 9e-47 45
MCA0676 YP_113189.1 phage integrase site specific recombinase VFG0783 Protein 2e-47 42
MCA0676 YP_113189.1 phage integrase site specific recombinase VFG0598 Protein 4e-47 41