Gene Information

Name : MCA1339 (MCA1339)
Accession : YP_113801.1
Strain : Methylococcus capsulatus Bath
Genome accession: NC_002977
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1424053 - 1424460 bp
Length : 408 bp
Strand : -
Note : identified by similarity to SP:P06688; match to protein family HMM PF00376; match to protein family HMM TIGR02051

DNA sequence :
ATGGAGAACACTCAAGAGAACCTGACCATCGGCGCCTTCGCCAAGGCCGCCGGGGTCAACGTGGAGACGATCCGCTTCTA
CCAGCTCAAGGGCTTGCTGCCCCGGCCGGAGCGGCCTTATGGGGGCATCCGCCGTTACGGGCGGACGGACGTGGCGCGGG
TGAAATTCGTGAAATCAGCCCAACGCCTGGGGTTCAGCCTGGATGAAGTCGGCCGGCTCCTGAAACTCGAGGACGGCACC
CATTGCAGCGAAGCCGCCGAACTGGCCGCCCACCGGCTGGCGGAGGTACGCGCCCGCCTGACAGACTTACAGCGGATGGA
GGCAGCGCTGGCGAAGCTGGTTGGCGAGTGCAAGGCGCATAGCGGCGACGTTTCCTGCCCATTGATCGCGGCATTGCACT
GCTGCTGA

Protein sequence :
MENTQENLTIGAFAKAAGVNVETIRFYQLKGLLPRPERPYGGIRRYGRTDVARVKFVKSAQRLGFSLDEVGRLLKLEDGT
HCSEAAELAAHRLAEVRARLTDLQRMEAALAKLVGECKAHSGDVSCPLIAALHCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-44 87
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-36 70
merR ACK44535.1 MerR Not tested SGI1 Protein 6e-37 70
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 6e-37 70
merR AFG30124.1 MerR Not tested PAGI-2 Protein 6e-37 70
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 8e-37 70
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-36 70
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-36 70
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-36 69
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-36 69
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-20 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0688 Protein 1e-38 73
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0232 Protein 5e-37 70
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0684 Protein 3e-38 70
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0683 Protein 3e-38 70
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0687 Protein 5e-37 70
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0686 Protein 3e-38 70
MCA1339 YP_113801.1 mercuric resistance operon regulatory protein BAC0689 Protein 8e-37 69