|
Name : rplS (SERP0807) Accession : YP_188390.1 Strain : Staphylococcus epidermidis RP62A Genome accession: NC_002976 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L19 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0335 EC number : - Position : 808032 - 808382 bp Length : 351 bp Strand : + Note : this protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site DNA sequence : ATGAGTAATCATAAGTTAATCGAAGCAGTAACTAAATCACAATTACGTACTGATTTACCCACTTTCCGTTCAGGAGACAC TTTACGTGTACACGTAAGAATCGTTGAAGGTTCTCGCGAACGTATCCAAGTTTTCGAAGGTGTTGTAATTAAACGCCGTG GTGGAGGAATTTCAGAAACTTTCACAGTTCGTAAAATTTCTTCTGGTGTAGGTGTGGAAAGAACTTTCCCATTACACACG CCTAAAATCGAAAAAATTGAAGTTAAACGTCGTGGTAAAGTACGTCGTGCTAAATTATATTACCTACGTAGTTTACGTGG TAAAGCTGCTAGAATTCAAGAAATTCGCTAA Protein sequence : MSNHKLIEAVTKSQLRTDLPTFRSGDTLRVHVRIVEGSRERIQVFEGVVIKRRGGGISETFTVRKISSGVGVERTFPLHT PKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rplS | CAA68924.1 | ribosomal protein L19 | Not tested | Internalin | Protein | 4e-41 | 78 |
| rplS | AAS66827.1 | 50S ribosomal subunit protein | Not tested | SSR-1 | Protein | 6e-27 | 56 |
