
|
Name : SERP2514 (SERP2514) Accession : YP_190056.1 Strain : Staphylococcus epidermidis RP62A Genome accession: NC_002976 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG1937 EC number : - Position : 2569870 - 2570130 bp Length : 261 bp Strand : - Note : identified by similarity to GP:14020990; match to protein family HMM PF02583 DNA sequence : ATGACTTATGATAAAAAAATGATTAATCGTATAAATAGAATACAAGGTCAATTAAATGGTGTCGTAAAAATGATGGAAGA AGAAAAAGATTGCAAAGATATAATTACGCAACTTAGTGCATCTAAAGGTTCTATACAACGTTTAATGGGGATTATAATTA GTGAAAATTTAATAGAATGCGTTAAAACAGCAGAAGAAAATAATGAAAGTTCTCAAGAATTAATTAATGAAGCAGTTAAT TTATTAGTTAAAAGTAAATAA Protein sequence : MTYDKKMINRINRIQGQLNGVVKMMEEEKDCKDIITQLSASKGSIQRLMGIIISENLIECVKTAEENNESSQELINEAVN LLVKSK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-33 | 100 |
| unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 3e-33 | 100 |
| SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-33 | 100 |
| SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-33 | 100 |
| unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 3e-33 | 100 |
| unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-33 | 100 |
| SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 3e-33 | 100 |
| unnamed | BAA82170.2 | - | Not tested | Type-II SCCmec | Protein | 3e-30 | 85 |
| unnamed | BAA86632.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-30 | 85 |
| unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 3e-27 | 83 |
| unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-27 | 83 |
| SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 7e-30 | 82 |
| SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 9e-30 | 81 |