|
Name : SERP2468 (SERP2468) Accession : YP_190011.1 Strain : Staphylococcus epidermidis RP62A Genome accession: NC_002976 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 2521032 - 2521253 bp Length : 222 bp Strand : + Note : identified by similarity to GP:14021030 DNA sequence : ATGAACCATGACACTACACAATCAGATTGGCGAACAGTTACTAGTTGTTTAGCCTCACAGAATTATATTTCGATATTAAA AGGTCTAGTTCACCATTTCACAGCCATCGATGATGAGGAAATACTTGATAAAATCTATGATGATTTTATGAATAATGACT CTATAACAACGGTACTTAACAATGATTTACAGATGATTATTAACCCATACCTATCAAAATGA Protein sequence : MNHDTTQSDWRTVTSCLASQNYISILKGLVHHFTAIDDEEILDKIYDDFMNNDSITTVLNNDLQMIINPYLSK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAS0028 | YP_042161.1 | hypothetical protein | Not tested | SCC476 | Protein | 6e-25 | 87 |
| unnamed | ACL99848.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 1e-24 | 87 |
| unnamed | BAC53817.1 | hypothetical protein | Not tested | SRImec-III and SCCmec-III region | Protein | 1e-24 | 85 |
| unnamed | BAB47654.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 1e-24 | 85 |
| SH0060 | YP_251975.1 | hypothetical protein | Not tested | SCCmec | Protein | 3e-21 | 77 |
| SE0029 | NP_763584.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 7e-23 | 77 |
