Gene Information

Name : SERP2468 (SERP2468)
Accession : YP_190011.1
Strain : Staphylococcus epidermidis RP62A
Genome accession: NC_002976
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2521032 - 2521253 bp
Length : 222 bp
Strand : +
Note : identified by similarity to GP:14021030

DNA sequence :
ATGAACCATGACACTACACAATCAGATTGGCGAACAGTTACTAGTTGTTTAGCCTCACAGAATTATATTTCGATATTAAA
AGGTCTAGTTCACCATTTCACAGCCATCGATGATGAGGAAATACTTGATAAAATCTATGATGATTTTATGAATAATGACT
CTATAACAACGGTACTTAACAATGATTTACAGATGATTATTAACCCATACCTATCAAAATGA

Protein sequence :
MNHDTTQSDWRTVTSCLASQNYISILKGLVHHFTAIDDEEILDKIYDDFMNNDSITTVLNNDLQMIINPYLSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0028 YP_042161.1 hypothetical protein Not tested SCC476 Protein 6e-25 87
unnamed ACL99848.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-24 87
unnamed BAB47654.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-24 85
unnamed BAC53817.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 1e-24 85
SH0060 YP_251975.1 hypothetical protein Not tested SCCmec Protein 3e-21 77
SE0029 NP_763584.1 hypothetical protein Not tested SCCpbp4 Protein 7e-23 77