Gene Information

Name : SERP2443 (SERP2443)
Accession : YP_189987.1
Strain : Staphylococcus epidermidis RP62A
Genome accession: NC_002976
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2499631 - 2500392 bp
Length : 762 bp
Strand : -
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGCGTTATCTCAAGAAAGTAACGATATACATAAGTTTATTAATTTTGGTAAGTGGTTGTGGAAACGGTAAAGAAACGGA
AATCAAACAAAACTTTAATAAAATGTTAGACATGTATCCGACTAAAAATCTAGAAGACTTTTATGATAAAGAAGGCTATC
GAGATGAAGAGTTTGATAAAAAGGATAAAGGGACATGGATAGTTGGATCTACCATGACAATTGAACCAAAAGGCAAGTAC
ATGGAATCTAGAGGTATGTTTCTATATATTAATCGCAATACTAGAACAACTAAAGGTTATTATTATGTGAGGAAAACAAC
AGATGACAGTAAAGGTAGACTAAAAGATGATGAAAAGAGATATCCTGTAAAAATGGAACACAATAAAATTATTCCAACGA
AGCCAATACCTAATGACAAACTAAAAAAAGAAATAGAAAACTTCAAATTTTTTGTACAATATGGAGATTTTAAAAACTTA
AAGGATTATAAAGATGGTGACATTTCATACAATCCTAATGTACCTAGTTATTCTGCAAAATATCAATTGAGTAATAATGA
CTATAATGTAAAACAATTACGAAAAAGATATGATATTCCCACCAACCAAGCCCCTAAATTATTGTTAAAAGGAGATGGTG
ACTTAAAAGGCTCATCTATAGGTTCCAAAAGTTTAGAATTTACTTTTATAGAAAATAAAGAAGAGAATATCTTTTTTTCA
GATGGTGTACAATTTACTCCTAGCGAGGATAGTGAGTCATGA

Protein sequence :
MRYLKKVTIYISLLILVSGCGNGKETEIKQNFNKMLDMYPTKNLEDFYDKEGYRDEEFDKKDKGTWIVGSTMTIEPKGKY
MESRGMFLYINRNTRTTKGYYYVRKTTDDSKGRLKDDEKRYPVKMEHNKIIPTKPIPNDKLKKEIENFKFFVQYGDFKNL
KDYKDGDISYNPNVPSYSAKYQLSNNDYNVKQLRKRYDIPTNQAPKLLLKGDGDLKGSSIGSKSLEFTFIENKEENIFFS
DGVQFTPSEDSES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL26684.1 unknown Not tested SCCcap1 Protein 6e-48 67
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 8e-72 66
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 2e-65 66
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 2e-65 66
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 5e-73 64
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 8e-72 64
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 8e-72 64
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 3e-66 64
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 3e-66 64
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 3e-66 64
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 7e-66 64
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 6e-65 63
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 5e-69 62
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 1e-67 61
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 1e-67 61
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 4e-68 61
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 4e-68 61
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 4e-68 61
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-61 60
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 9e-66 58
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 9e-66 58
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 9e-66 58
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-65 58
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 4e-47 53
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 9e-47 53
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 2e-47 53
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 9e-47 53
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 1e-47 53
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 3e-47 52
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 3e-46 52
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 6e-45 51
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-45 51
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-51 50
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 2e-45 50
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 2e-45 50
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 3e-50 49
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 2e-50 49
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 4e-47 49
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 2e-48 49
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 2e-48 49
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 3e-49 49
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 3e-54 49
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 6e-50 49
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 1e-51 49
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 3e-43 49
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 3e-43 49
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-50 49
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-50 49
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-46 49
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 3e-48 48
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 3e-48 48
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 7e-47 48
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 1e-49 48
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 7e-47 48
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 1e-49 48
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 3e-49 48
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 7e-47 48
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 2e-49 48
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 1e-49 48
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 3e-49 48
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 1e-49 48
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 7e-46 48
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 3e-48 47
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 9e-47 47
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 8e-50 47
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 8e-50 47
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 1e-49 47
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 7e-48 47
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 8e-50 47
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-47 47
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-49 47
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 2e-49 47
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 3e-45 47
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-49 47
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 1e-46 46
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 1e-46 46
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 1e-46 46
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 4e-43 46