Gene Information

Name : SAS0031 (SAS0031)
Accession : YP_042164.1
Strain : Staphylococcus aureus MSSA476
Genome accession: NC_002953
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 42024 - 42365 bp
Length : 342 bp
Strand : -
Note : Ortholog of S. aureus MRSA252 (BX571856) SAR0058; Similar to Staphylococcus aureus hypothetical 13.8 kDa protein SWALL:Q9LBZ1 (EMBL:AB033763) (116 aa) fasta scores: E(): 3.7e-44, 96.42% id in 112 aa

DNA sequence :
ATGAAAACAACCACTCAAGAACTCAAACAATATATAACTCGTCTATTCCAACTATCTAACAATGAAACATGGGAATGTGA
AGCGTTAGAAGAAGCAGCAGAAAATATACTTCCTACTCGCTTTGTAGACCATACCCCACTTGCGCATCTTACACTTGAAA
CTTATACCTACTATAACGATGAACTACATGAGCTAAGTATCTATCCATTTCTTATGTACGCCAATAACCAACTCATCAGT
ATTGGTTATCTGGATCATTTTGATATGGACTTTCTATACCTCACAGATACTAAAAATACAATTATCGATGAACGTCATCT
ATTACAAAAAGGAGGAGAATAA

Protein sequence :
MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLETYTYYNDELHELSIYPFLMYANNQLIS
IGYLDHFDMDFLYLTDTKNTIIDERHLLQKGGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 1e-47 100
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 4e-41 97
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-41 97
unnamed BAB83488.1 - Not tested SCC 12263 Protein 6e-46 95
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-39 91
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-39 91
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 1e-39 91
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-39 91
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 1e-38 90
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 5e-39 90
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-36 87
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-36 87
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-36 87
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-36 87
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-36 87
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 9e-36 86
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 6e-31 57
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-31 57
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-31 56
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-31 56
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-31 56
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-29 55
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-25 53
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-25 53
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 8e-27 53
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 1e-25 53
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 4e-25 52
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-23 51
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 1e-23 51
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 4e-24 51
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 6e-24 50