Gene Information

Name : SAS0029 (SAS0029)
Accession : YP_042162.1
Strain : Staphylococcus aureus MSSA476
Genome accession: NC_002953
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 41101 - 41604 bp
Length : 504 bp
Strand : -
Note : Ortholog of S. aureus MRSA252 (BX571856) SAR0056; Similar to Staphylococcus aureus hypothetical protein SA0054 SWALL:Q99XD7 (EMBL:AP003358) (172 aa) fasta scores: E(): 2.6e-59, 94.61% id in 167 aa

DNA sequence :
ATGAATACAATTAAAAGTACAATACACACAGAAGCCATATTTAGCGATGACAAACAGCACCGCTATTTACTCAAGAAAAC
TTGGGATGAAAAGAAACCAGCTTGTACAGTGATAACGATGTACCCCCATTTAGATGGTGTGTTATCACTCGATCTTACTA
CTGTTCTTATTCTTAACCAATTAGCGAATTCTGAACAATATGGTGCTGTATATCTTGTGAATCTATTTTCAAATATTAAA
ACCCCAGAGAACCTTAAACATATCAAAGAGCCTTATGACAAACACACAGACATTCACTTGATGAAGACGATTAGTGAAAG
TGACACAGTGATTCTAGCTTATGGCGCCTATGCTAAGCGACCAGTTGTTATAGAACGTGTATCACAGGTGATGGAAATGT
TAAAACCTCATAAAAAGAAAGTCAAAAAGCTCATAAATCCAGCAACAAATGAAATTATGCATCCACTCAATCCTAAAGCG
CGTCAAAAATGGACATTGAAATAA

Protein sequence :
MNTIKSTIHTEAIFSDDKQHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANSEQYGAVYLVNLFSNIK
TPENLKHIKEPYDKHTDIHLMKTISESDTVILAYGAYAKRPVVIERVSQVMEMLKPHKKKVKKLINPATNEIMHPLNPKA
RQKWTLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 1e-69 100
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 9e-69 98
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-68 96
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-59 96
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 1e-66 95
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-66 95
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-66 95
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 2e-67 95
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-66 95
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-66 95
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-66 94
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-66 94
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 9e-67 94
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-67 94
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 1e-66 94
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 1e-66 94
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-66 94
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 1e-66 94
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 2e-65 93
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 7e-67 92
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 3e-50 69
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 7e-49 68
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 7e-49 68
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-50 68
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 9e-50 68
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-49 68
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-48 68
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 1e-44 64
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 2e-43 63
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 7e-46 63
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 7e-46 63