Name : SAS0028 (SAS0028) Accession : YP_042161.1 Strain : Staphylococcus aureus MSSA476 Genome accession: NC_002953 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 40866 - 41087 bp Length : 222 bp Strand : - Note : Similar to Staphylococcus aureus hypothetical 9.2 kDa protein SWALL:Q93IA3 (EMBL:AB037671) (80 aa) fasta scores: E(): 1.1e-24, 89.04% id in 73 aa, and to Staphylococcus aureus hypothetical 8.0 kDa protein SWALL:Q93ID7 (EMBL:AB037671) (68 aa) fasta scores: DNA sequence : ATGAACCATGAAACTACACAATCAGACTGGCGAACGGTTCCTAATTGCTTAGCATCTCAAAATTATATATCTATCGTAAA AGGACTAGTACATCATTTTACAGCGATTGAAGATGAAGAAATACTTGATAAAATCTATGACGATTTTATGGATGATGACT CTATAACAACGGTCCTTAATAATGATTTACAGACAATTATTAACCATTATCTATTAAAATGA Protein sequence : MNHETTQSDWRTVPNCLASQNYISIVKGLVHHFTAIEDEEILDKIYDDFMDDDSITTVLNNDLQTIINHYLLK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SAS0028 | YP_042161.1 | hypothetical protein | Not tested | SCC476 | Protein | 3e-28 | 100 |
unnamed | BAC53817.1 | hypothetical protein | Not tested | SRImec-III and SCCmec-III region | Protein | 2e-25 | 90 |
unnamed | BAB47654.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-25 | 90 |
unnamed | ACL99848.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 4e-25 | 88 |
SH0060 | YP_251975.1 | hypothetical protein | Not tested | SCCmec | Protein | 1e-21 | 83 |
SE0029 | NP_763584.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 2e-23 | 79 |