Gene Information

Name : SAS1866 (SAS1866)
Accession : YP_043981.1
Strain : Staphylococcus aureus MSSA476
Genome accession: NC_002953
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2026654 - 2027004 bp
Length : 351 bp
Strand : -
Note : Ortholog of S. aureus MRSA252 (BX571856) SAR2035

DNA sequence :
ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTAGTAACTAATCTAGATAAAAA
TGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAATATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTAT
TAGATGAACTAAATGTTAATGAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCAA
AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAACTTCAAAAGATTTATAATGA
AATTGACGAAGCACTAAAAAGTAAATATTAA

Protein sequence :
MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQ
KAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
MW1884 NP_646701.1 hypothetical protein Not tested ¥ÕSa3 Protein 9e-46 100
SAV1942 NP_372466.1 hypothetical protein Not tested ¥ÕSa3 Protein 9e-46 100
SAUSA300_1919 YP_494570.1 hypothetical protein Not tested ¥ÕSa3 Protein 9e-46 100
SAUSA300_1919 YP_494570.1 hypothetical protein Not tested ¥ÕSa3 Protein 9e-46 100
SAKOR_01918 YP_008492106.1 Complement inhibitor SCIN Not tested ¥ÕSa3 Protein 7e-31 99
SA1754 NP_375049.1 hypothetical protein Not tested ¥ÕSa3 Protein 7e-45 99
SAOV_2052c YP_005737495.1 staphylococcal complement inhibitor (scin) related protein Not tested SaPI2 Protein 2e-19 48
SAUSA300_1056 YP_493754.1 hypothetical protein Not tested vSa¥ã Protein 5e-18 46
SAKOR_01080 YP_008491268.1 Hypothetical protein Not tested vSa¥ã Protein 5e-18 46
SACOL1169 YP_186032.1 fibrinogen-binding protein precursor-like protein Not tested vSa¥ã Protein 5e-18 46
MW1041 NP_645858.1 hypothetical protein Not tested vSa¥ã Protein 5e-18 46
SAV1159 NP_371683.1 fibrinogen-binding protein Not tested vSa¥ã Protein 5e-18 46
SA1004 NP_374275.1 hypothetical protein Not tested vSa¥ã Protein 5e-18 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAS1866 YP_043981.1 hypothetical protein VFG2423 Protein 3e-46 100