
|
Name : SAS1747a (SAS1747a) Accession : YP_043863.1 Strain : Staphylococcus aureus MSSA476 Genome accession: NC_002953 Putative virulence/resistance : Virulence Product : lantibiotic protein Function : - COG functional category : - COG ID : - EC number : - Position : 1897428 - 1897571 bp Length : 144 bp Strand : - Note : Similar to Staphylococcus gallinarum lantibiotic gallidermin precursor GdmA SWALL:LANG_STAGA (SWALL:P21838) (52 aa) fasta scores: E(): 3.1e-07, 51.11% id in 45 aa, and to Staphylococcus epidermidis lantibiotic epidermin precursor EpiA SWALL:LANE_STAEP (SW DNA sequence : TTGGAAAAAGTTCTTGATTTAGACGTGCAAGTTAAAGGAAATAACAACACTAATGATTCAGCGGGTGACGAAAGAATAAC TAGCCATCTTTTTTGTAGCTTTGGTTGTGAAAAGACGGGTAGTTTTAACAGCTTCTGTTGTTAA Protein sequence : MEKVLDLDVQVKGNNNTNDSAGDERITSHLFCSFGCEKTGSFNSFCC |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| bsaA1 | YP_001332751.1 | lantibiotic precursor | Not tested | vSa¥â | Protein | 2e-15 | 100 |
| bsaA1 | NP_646583.1 | hypothetical protein | Not tested | vSa¥â | Protein | 2e-15 | 100 |
| epiA | YP_186705.1 | lantibiotic epidermin precursor EpiA | Virulence | vSa¥â | Protein | 2e-12 | 86 |
| bsaA2 | NP_646582.1 | hypothetical protein | Not tested | vSa¥â | Protein | 2e-12 | 86 |
| bsaA2 | YP_001332750.1 | lantibiotic precursor | Not tested | vSa¥â | Protein | 2e-12 | 86 |
| epiA | YP_494458.1 | lantibiotic epidermin biosynthesis protein EpiA | Not tested | vSa¥â | Protein | 2e-12 | 86 |