Gene Information

Name : SAS1746 (SAS1746)
Accession : YP_043862.1
Strain : Staphylococcus aureus MSSA476
Genome accession: NC_002953
Putative virulence/resistance : Virulence
Product : lantibiotic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1896548 - 1896691 bp
Length : 144 bp
Strand : -
Note : Similar to Staphylococcus gallinarum lantibiotic gallidermin precursor GdmA SWALL:LANG_STAGA (SWALL:P21838) (52 aa) fasta scores: E(): 1.7e-09, 64.44% id in 45 aa, and to Staphylococcus epidermidis lantibiotic epidermin precursor EpiA SWALL:LANE_STAEP (SW

DNA sequence :
ATGGAAAAAGTTCTTGATTTAGACGTGCAAGTTAAAGCAAACAATAACTCAAATGATTCAGCAGGTGACGAACGTATTAC
AAGTCATAGTTTATGTACTCCTGGTTGTGCTAAGACTGGTAGTTTTAATAGCTTCTGCTGTTAA

Protein sequence :
MEKVLDLDVQVKANNNSNDSAGDERITSHSLCTPGCAKTGSFNSFCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
epiA YP_186705.1 lantibiotic epidermin precursor EpiA Virulence vSa¥â Protein 3e-15 100
bsaA2 NP_646582.1 hypothetical protein Not tested vSa¥â Protein 3e-15 100
bsaA2 YP_001332750.1 lantibiotic precursor Not tested vSa¥â Protein 3e-15 100
epiA YP_494458.1 lantibiotic epidermin biosynthesis protein EpiA Not tested vSa¥â Protein 3e-15 100
bsaA1 YP_001332751.1 lantibiotic precursor Not tested vSa¥â Protein 2e-12 86
bsaA1 NP_646583.1 hypothetical protein Not tested vSa¥â Protein 2e-12 86