Name : SAR0874 (SAR0874) Accession : YP_040296.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG3237 EC number : - Position : 911965 - 912159 bp Length : 195 bp Strand : + Note : Similar to Bacillus subtilis sigmaB regulated hypothetical protein CsbD SW:CSBD_BACSU (P70964) (62 aa) fasta scores: E(): 0.0038, 42.553% id in 47 aa, and to Streptococcus pyogenes hypothetical protein SPY1261 TR:Q99ZE6 (EMBL:AE006565) (66 aa) fasta score DNA sequence : ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAATGTTACTGATAATAAAAATTT AGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCGAAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATT TTATTGATAAAGTAAAAGGTAACAAAGGAGAGTAA Protein sequence : MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SAAV_0811 | YP_003281734.1 | hypothetical protein | Not tested | SaPIAv | Protein | 3e-20 | 100 |
Cp1002_1471 | YP_005681738.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 0.004 | 44 |
CpC231_1473 | YP_005683837.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 0.004 | 44 |
cpfrc_01480 | YP_003783880.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 0.004 | 44 |
CpI19_1480 | YP_005685923.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 0.004 | 44 |