Gene Information

Name : SAR0716 (SAR0716)
Accession : YP_040144.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 751371 - 751463 bp
Length : 93 bp
Strand : +
Note : Nosignificant database matches. Similar to SAR1888, 72.414% identity (72.414% ungapped) in 29 aa overlap, and to SAR0706, 55.556% identity (55.556% ungapped) in 27 aa overlap

DNA sequence :
TTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTTAGTAA
ACGCAACAAATAA

Protein sequence :
MLIIFVHIIAPVISGCAVAYYTYWLSKRNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SERP2235 YP_189788.1 hypothetical protein Not tested vSe1 Protein 2e-06 77
SH2302 YP_254217.1 hypothetical protein Not tested ¥ðSh1 Protein 7e-05 60
SH2616 YP_254531.1 hypothetical protein Not tested ¥ðSh2 Protein 8e-04 57
SH2604 YP_254519.1 hypothetical protein Not tested ¥ðSh2 Protein 5e-04 54