|
Name : SAR0706 (SAR0706) Accession : YP_040140.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 746977 - 747081 bp Length : 105 bp Strand : - Note : No significant database matches. Similar to SAR1888, 50.000% identity (50.000% ungapped) in 28 aa overlap, and to SAR0716, 55.556% identity (55.556% ungapped) in 27 aa overlap DNA sequence : GTGCGATTTATGAATGAAATTCTTGTTCACATCATGACAACGGCAATCAGTGGTTGTCTCGTTACGTTATTTGGTTATTG GCTCCATAAACGTGATAAAAAATAA Protein sequence : MRFMNEILVHIMTTAISGCLVTLFGYWLHKRDKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2616 | YP_254531.1 | hypothetical protein | Not tested | ¥ðSh2 | Protein | 7e-06 | 65 |
| SH2302 | YP_254217.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 1e-04 | 62 |
| SH2604 | YP_254519.1 | hypothetical protein | Not tested | ¥ðSh2 | Protein | 8e-05 | 62 |
| SERP2235 | YP_189788.1 | hypothetical protein | Not tested | vSe1 | Protein | 0.010 | 50 |
