|
Name : arsR1 (SAR0690) Accession : YP_040127.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Resistance Product : arsenical resistance operon repressor 1 Function : - COG functional category : K : Transcription COG ID : COG0640 EC number : - Position : 736085 - 736399 bp Length : 315 bp Strand : + Note : Highly similar to Staphylococcus aureus plasmid pI258 arsenical resistance operon repressor ArsR SW:ARSR_STAAU (P30338) (104 aa) fasta scores: E(): 2.9e-40, 99.038% id in 104 aa, and to Staphylococcus xylosus plasmid pSX267 arsenical resistance operon rep DNA sequence : ATGTCTTATAAAGAACTATCAACAATATTAAAAATTTTATCAGATTCAAGTAGGTTAGAAATATTAGATTTACTTTCTTG TGGTGAGCTATGCGCTTGTGACTTATTAGAACACTTTCAATTCTCACAACCTACACTAAGTCATCATATGAAGTCATTAG TAGATAATGAATTAGTTACAACACGAAAAGACGGCAATAAACATTGGTATCAACTTAATCATGCTATTTTAGATGATATT ATCCAAAACTTGAACATCATTAATACATCTAATCAAAGATGTGTATGTAAAAATGTGGAATCAGGTGACTGTTGA Protein sequence : MSYKELSTILKILSDSSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWYQLNHAILDDI IQNLNIINTSNQRCVCKNVESGDC |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| arsR | YP_005754066.1 | arsenical resistance operon repressor | Not tested | Type-XI SCCmec | Protein | 1e-30 | 78 |
| arsR | YP_252018.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 6e-29 | 72 |
| arsR | YP_252025.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 1e-27 | 68 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| arsR1 | YP_040127.1 | arsenical resistance operon repressor 1 | BAC0590 | Protein | 3e-36 | 99 |
| arsR1 | YP_040127.1 | arsenical resistance operon repressor 1 | BAC0592 | Protein | 2e-32 | 86 |
