Name : mecI (SAR0041) Accession : YP_039517.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Resistance Product : methicillin resistance regulatory protein MecI Function : - COG functional category : K : Transcription COG ID : COG3682 EC number : - Position : 48782 - 49126 bp Length : 345 bp Strand : + Note : Previously sequenced as Staphylococcus epidermidis, and Staphylococcus aureus methicillin resistance regulatory protein MecI SW:MECI_STAEP (P26598) (123 aa) fasta scores: E(): 2.5e-41, 100.000% id in 114 aa. Similar to and to Staphylococcus haemolyticus b DNA sequence : ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGC GAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATA AAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGA TCTATCACAAGATGAAATAGAATAA Protein sequence : MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKY KTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | Not tested | Type-II SCCmec | Protein | 4e-46 | 100 |
mecI | BAA82218.1 | methicillin resistance protein MecI | Not tested | Type-II SCCmec | Protein | 2e-46 | 100 |
mecI | NP_373280.1 | methicillin resistance regulatory protein | Not tested | Type-II SCCmec | Protein | 3e-46 | 100 |
mecI | YP_190060.1 | methicillin-resistance regulatory protein MecI | Not tested | Type-II SCCmec | Protein | 3e-46 | 100 |
mecI | NP_370567.1 | methicillin resistance regulatory protein | Not tested | Type-II SCCmec | Protein | 2e-45 | 99 |
mecI | YP_005754043.1 | methicillin resistance regulatory protein MecI | Not tested | Type-XI SCCmec | Protein | 3e-34 | 66 |
blaI | YP_253677.1 | beta-lactamase repressor | Not tested | ¥ÕSh1 | Protein | 9e-23 | 60 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_002952.2861158.p0 | Protein | 1e-46 | 100 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_002745.1122814.p0 | Protein | 9e-47 | 100 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_002758.1120003.p0 | Protein | 5e-46 | 99 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_009782.5560220.p0 | Protein | 5e-46 | 99 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | FR823292.1.gene6.p01 | Protein | 1e-34 | 66 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_010419.6155809.p0 | Protein | 4e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_010066.5774788.p0 | Protein | 3e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_005054.2598289.p0 | Protein | 3e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_003140.1122763.p0 | Protein | 4e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_005011.2598314.p0 | Protein | 3e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_005951.2853407.p0 | Protein | 3e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | NC_002952.2858973.p0 | Protein | 3e-23 | 60 |
mecI | YP_039517.1 | methicillin resistance regulatory protein MecI | AM180355.1.gene595.p | Protein | 4e-17 | 46 |