Gene Information

Name : SAR0038 (SAR0038)
Accession : YP_039514.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : I : Lipid transport and metabolism
COG ID : COG2030
EC number : -
Position : 44445 - 44873 bp
Length : 429 bp
Strand : +
Note : Previously sequenced as Staphylococcus aureus hypothetical protein TR:BAB47625 (EMBL:AB037671) (142 aa) fasta scores: E(): 2e-52, 100.000% id in 142 aa. Similar to Bacillus subtilis YdeM protein ydeM TR:P96670 (EMBL:AB001488) (141 aa) fasta scores: E(): 1

DNA sequence :
ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACAGAAGAAGAAATTATCCAATT
TGCAACAACTTTTGATCCTCAATATATGCATATAGATAAAGAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCAT
CTGGCATGCATACACTTTCAATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACA
CAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATCGCTGAAATTACAAATAAGAA
ATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTTTCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAG
AAGTAACAGCACTTATTAATAATTCATAA

Protein sequence :
MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGT
QMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB72114.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-61 100
SA0037 NP_373277.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-61 100
unnamed BAB72133.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-61 100
SAPIG0041 YP_005732851.1 MaoC like domain, putative Not tested Type-V SCCmec Protein 3e-61 100
unnamed BAA82222.2 - Not tested Type-II SCCmec Protein 2e-61 100
SAUSA300_0031 YP_492751.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-61 100
unnamed BAD24825.1 conserved hypothetical protein Not tested Type-V SCCmec Protein 2e-61 100
SERP2522 YP_190063.1 acyl dehydratase MaoC Not tested Type-II SCCmec Protein 3e-61 100
maoC YP_184943.1 MaoC domain-containing protein Not tested Type-I SCCmec Protein 3e-61 100
unnamed ACL99837.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-61 100
SH0090 YP_252005.1 hypothetical protein Not tested SCCmec Protein 3e-61 100
SAR0038 YP_039514.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-61 100
unnamed BAG06198.1 MaoC domain protein dehydratase Not tested Type-VII SCCmec Protein 2e-61 100
SAMSHR1132_00310 YP_005324555.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-61 100
unnamed BAB47625.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-61 100
MW0030 NP_644845.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-61 100
unnamed BAC57477.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-61 100
SAV0040 NP_370564.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-61 100
unnamed BAA94333.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-61 99