Gene Information

Name : SAR0445 (SAR0445)
Accession : YP_039894.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 472568 - 473389 bp
Length : 822 bp
Strand : +
Note : No significant database matches. Similar to SAR0444, 55.351% identity (57.034% ungapped) in 271 aa overlap, SAR2573, 50.373% identity (52.326% ungapped) in 268 aa overlap, and SAR0106, 50.000% identity (53.571% ungapped) in 270 aa overlap

DNA sequence :
ATGATGGAGTATATAAAAAAAATTGCTTTGTACATGAGTGTATTACTTTTAATCATTTTTATTGGGGGATGTGGAAATAT
GAAAGATGAACAGAAAAAAGAGGAACAAACAAATAAAACAGATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGCGAAAA
CGTTAGATATGTATCCAATTAAGAATCTCGAGGATTTATACGACAAAGAAGGCTATCGAGATGGCGAATTTGAAAAAGGT
GACAAAGGGATGTGGGTTCTGTATTCATCTATTGTATCAGAATTCAAAGGCGAGAGTTTAAAATCACGAGGAATGATATT
AAAGTTAGATAGAAATAAGAGAACTGCTAAAGGAAGTTATATTATAAGAGAATTGAAAGAAGATAAAAATCATGATGTTC
AAAAAAACGAAAAAAAGTATCCAGTTAAATTGGTGAATAATAAAATAATTCCAACTGAAGATGTAAAAAACGAAGATTTA
AAAAGAGAAATTGAAAACTTCAAATTATTTTCTCAATATGGTGAATTTAAGAGTTTAAATACGGATAGGATAACAAATAT
TTCTTATAATCCTAATGCGCCTAACTATTCAGCTGAATATAAAATTAATGATGATGATAATAACATCAAACAATTAAAAA
ATCGATTCAATATTAAGTCTAATAAAAATCCTAAGTTATTGTTCAAAGGAGCAGGTAATATAAAAGGGTCTTCTGTTGGA
TATAAGGAGATACAGATAATTTTCAATAGGAACAAAGAAGAAAGTGTTTCTTGTATTGATAGTATAGAGTTTAAACCGAG
TGAAGGAGACTATAATGAGTAA

Protein sequence :
MMEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKG
DKGMWVLYSSIVSEFKGESLKSRGMILKLDRNKRTAKGSYIIRELKEDKNHDVQKNEKKYPVKLVNNKIIPTEDVKNEDL
KREIENFKLFSQYGEFKSLNTDRITNISYNPNAPNYSAEYKINDDDNNIKQLKNRFNIKSNKNPKLLFKGAGNIKGSSVG
YKEIQIIFNRNKEESVSCIDSIEFKPSEGDYNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 8e-122 100
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 3e-84 75
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 3e-84 75
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 7e-72 60
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-68 60
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 3e-68 59
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 6e-69 59
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 3e-68 59
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 2e-68 58
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 8e-70 58
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 4e-69 58
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 4e-69 58
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-69 58
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 8e-70 57
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 8e-70 57
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 9e-68 56
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 9e-68 56
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 9e-68 56
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 4e-57 55
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 8e-65 55
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 3e-68 54
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 3e-68 54
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 9e-65 54
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 9e-65 54
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 9e-65 54
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 5e-61 54
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 5e-61 54
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 5e-61 54
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 7e-61 54
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 1e-66 53
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 4e-64 53
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 2e-64 53
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 2e-64 53
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 2e-60 53
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 2e-60 53
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 2e-62 52
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-64 52
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 2e-57 51
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 2e-57 51
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 1e-58 51
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 2e-57 50
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 2e-58 50
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 2e-58 50
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 2e-61 50
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 5e-59 50
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 4e-59 50
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 1e-59 50
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 3e-60 50
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-59 50
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 1e-55 49
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 5e-59 49
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 2e-56 49
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 1e-57 49
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 2e-56 49
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 5e-57 49
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-54 49
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 8e-57 49
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 1e-58 49
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-62 49
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 9e-55 48
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 3e-57 48
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-57 48
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 1e-57 48
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-57 48
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 1e-57 48
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 1e-57 48
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 5e-58 48
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 8e-57 48
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 6e-57 48
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 6e-57 48
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 1e-51 47
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 3e-56 47
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 3e-56 47
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 3e-52 47
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 3e-52 47
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-47 47
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 4e-55 46