Gene Information

Name : SAR0443 (SAR0443)
Accession : YP_039892.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 470789 - 471589 bp
Length : 801 bp
Strand : +
Note : No significant database matches. Similar to SAR0439, 77.692% identity (78.906% ungapped) in 260 aa overlap, SAR0442, 76.154% identity (77.647% ungapped) in 260 aa overlap, and SAR0438, 60.902% identity (62.548% ungapped) in 266 aa overlap

DNA sequence :
ATGAGATATTTAAATAGAGTTGTACTGTACATAATTGTTATGGTTTTGAGTGTTTTTATAATAGGTTGTGATAAATCAAG
CGATACTTCAGAAAAGCCAAAAGAAGATTCAAAAGAAGCACAAATTAAAAAGAGTTTTGAGAAAACATTAGATATGTATC
CAATTAAGAATCTCGAGGATTTATACGACAAAGAGGGATCTCGTGATGGTGAGTTTAAAAAAGGCGATAAAGGGATGTGG
ACGATATATACAGATTTCGCCAAAAGTAATAAACAAGGTGGATTGAGTAATGAAGGTATGGTCTTATACTTAGATAGAAA
TACACGGACAGCAAAGGGACATTATTTTGTTAAGACATTTTATGAAAAGGATAAATTCCCAGATAGAAAAAAATATAAAG
TTGAAATGAAAAACAATAAAATTATCTTATTAGACAAGGTAGAAGATCCAAAACTAAAAAAGAGAATAGAAAACTTTAAA
TTTTTCGGACAATATGCAAACCTTAAAGAATTGAAAAATTACAACAATGGTGATGTCTCAATTAATGAGAATGTTCCAAG
TTATGACGCAAAATTTAAAATGAGCAATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAATATTCCTACTGATA
AAGCACCGGTATTAAAAATGCATATTGATGGTAATTTGAAAGGAAGTTCTGTGGGTTATAAAAAGTTGGAAATTGACTTT
TCAAAAGGTGAAAAAAGCGATTTGTCAGTAATAGATTCTTTGAATTTCCAGCCGGCGAAGGTGAATGAAGATGATGAATG
A

Protein sequence :
MRYLNRVVLYIIVMVLSVFIIGCDKSSDTSEKPKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMW
TIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFYEKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFK
FFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDF
SKGEKSDLSVIDSLNFQPAKVNEDDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 1e-119 100
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 3e-99 95
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-113 94
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 1e-113 94
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 1e-113 94
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 5e-109 90
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 9e-106 88
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 7e-106 87
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 7e-105 87
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 7e-106 87
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 7e-106 87
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-104 86
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 7e-97 84
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 8e-100 82
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 8e-98 81
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 6e-98 81
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 4e-98 80
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 4e-98 80
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 2e-91 80
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-98 80
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 4e-95 79
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 1e-95 79
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-92 79
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 1e-91 78
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 4e-90 77
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 3e-90 77
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 3e-90 77
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 5e-89 77
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-92 77
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-90 77
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 9e-91 77
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 2e-89 76
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 2e-86 75
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 2e-86 75
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 2e-87 75
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 3e-81 69
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 3e-81 69
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-82 68
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 1e-80 65
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 1e-80 65
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 2e-78 64
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 2e-78 64
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-68 64
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 9e-78 63
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 8e-74 63
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 3e-69 62
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 8e-75 62
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 2e-74 61
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 3e-74 61
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 2e-74 61
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 4e-73 61
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 4e-73 61
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 5e-66 58
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 5e-66 58
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-61 56
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 3e-61 55
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 5e-60 55
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 5e-60 54
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 6e-57 54
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 6e-57 54
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 4e-51 53
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 4e-51 53
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 4e-51 53
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 3e-52 53
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 1e-56 52
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 1e-56 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 4e-53 52
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 3e-56 51
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 3e-56 51
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 3e-56 51
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-56 51
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 8e-49 50
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 2e-47 50
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 2e-47 50
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 4e-50 49
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 4e-50 49
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 8e-57 49