Gene Information

Name : SAR0442 (SAR0442)
Accession : YP_039891.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 469987 - 470757 bp
Length : 771 bp
Strand : +
Note : No significant database matches. Similar to SAR0439, 78.210% identity (78.516% ungapped) in 257 aa overlap, SAR0443, 76.154% identity (77.647% ungapped) in 260 aa overlap, SAR0438, 63.118% identity (63.602% ungapped) in 263 aa overlap, and SAR0444, 56.757

DNA sequence :
ATGGGATATTTAAAAAGGATTGGAATGTGCATAAGCCTATTGATTGTAATTATTTTTGTAACATCTTGCGGTGGTGGTAA
TAAGATCACTGGAGATTCAAAAGAAACACAAATCAAAAAGAGTTTTGCGAAAACGTTAGATATGTACCCAATCAAAAATC
TCGAGGACCTATATGATAAAGAAGGCTATCGAGATGGCGAATTTGAAAAAGGTGACAAAGGGATGTGGACGATATATACA
GATTTTGCTAAAAGCAATAAATCAGACGAATTGGATGATGAAGGTATGGTTTTAAATCTGGATAGAAATACTCGAACGGC
TAAGGGATATTATTTTGTTAAGAAATTTTATGAAAAGGATAAATTTTCAGATAGAAAAAATTATAAAGTTGAAATGAAAA
ACAATAAAATTATTTTATTAGACAAGGTAAACGATCCAAACCTTAAAGAAAGAATAGAAAATTTTAAGTTTTTTGGACAA
TATGCAAATTTTAAGGATTTGGAAAATTACAACAATGGCGATGTGTCAATAAATTGGAATGTTCCAAGTTATGACGTGGA
ATATAAAATGAGCAATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAACATTCCTACTGATAAAGCTCCAATGT
TAAAAATGCATATTGACGGGGACTTAAAAGGAAGTTCTGTTGGATATAAAAGGTTAGAAATAGACTTTTCAAAAGAAGAT
AGGGATATTTCAGTCATTGATTATTTAAGTTATAAGCCAGCGAAAAAATAG

Protein sequence :
MGYLKRIGMCISLLIVIIFVTSCGGGNKITGDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKGDKGMWTIYT
DFAKSNKSDELDDEGMVLNLDRNTRTAKGYYFVKKFYEKDKFSDRKNYKVEMKNNKIILLDKVNDPNLKERIENFKFFGQ
YANFKDLENYNNGDVSINWNVPSYDVEYKMSNKDENVKQLRSRYNIPTDKAPMLKMHIDGDLKGSSVGYKRLEIDFSKED
RDISVIDYLSYKPAKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 1e-114 100
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 7e-112 97
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 7e-112 97
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 4e-108 95
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 3e-107 94
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 3e-104 91
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 1e-85 86
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-99 83
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 5e-92 79
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-90 78
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 2e-90 78
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 2e-90 78
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 8e-92 78
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 8e-91 78
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-90 78
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 2e-90 77
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 2e-90 77
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 1e-83 77
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 1e-83 77
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-90 77
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-90 77
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 2e-89 76
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 2e-88 76
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 1e-91 76
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 1e-89 76
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 8e-90 76
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 3e-89 76
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 2e-89 76
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 3e-86 75
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 3e-86 75
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 1e-88 75
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 1e-88 75
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 1e-88 75
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-84 75
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 3e-89 75
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 2e-77 70
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-71 69
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-78 65
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 3e-76 63
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 6e-77 63
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-71 62
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-71 62
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 5e-75 62
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 5e-75 62
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 1e-72 61
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 1e-72 61
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-73 61
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-73 61
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 6e-73 60
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 5e-73 60
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 4e-73 60
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 1e-56 60
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 3e-71 59
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 58
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 2e-54 58
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 58
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 6e-52 57
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 6e-52 57
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 1e-60 56
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-56 53
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-56 53
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-56 53
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 4e-53 52
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 8e-55 52
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 8e-55 52
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 8e-55 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 7e-52 52
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 3e-56 52
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 3e-56 52
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 5e-57 51
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 8e-53 51
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 8e-53 51
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 9e-58 49
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-50 47
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-49 47
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 9e-50 47
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 9e-50 47