Gene Information

Name : SAR0439 (SAR0439)
Accession : YP_039890.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 468343 - 469116 bp
Length : 774 bp
Strand : +
Note : No significant database matches. Similar to SAR0442, 78.210% identity (78.516% ungapped) in 257 aa overlap, SAR0443, 77.692% identity (78.906% ungapped) in 260 aa overlap, and SAR0438, 63.672% identity (63.922% ungapped) in 256 aa overlap

DNA sequence :
ATGGGGTATTTAAAAAGGTTTGCATTGTACATAAGCGTTATGATTTTAATGTTTGCGATAGCAGGTTGTGGCAAAGGTAA
TGAAACAAAAGAAGGTTCAAAAGAAACACAAATCAAAAAGAGCTTTGCGAAAACGTTAGATATGTATCCAATCAAAAATC
TCGAGGATTTATACGACAAAGAAGGCTATAGAGATGGTGAATTTGAAAAAGGTGACAAAGGGATGTGGACGATATACACA
GATTTCGCTAAAAGTAATAAACCGGGTGAATTGGATGATGAAGGTATGGTTTTAAATCTGGATAGGAATACTAGAACCGC
TAAAGGCCATTATTTTGTTACTACATTTTACCGGAATGGTAAACTGCCAGATGAAAAGAATTATAAAATTGAAATGAAAA
ATAATAAGATTATTTTATTAGATGAAGTAAAAGATGATAAGCTCAAGCAGAAAATAGAAAATTTTAAATTTTTCGGTCAA
TATGCAAATCTTAAAGAATTGAAAAAATATAATAATGGTGATGTTTCAATTAATGAAAATGTTCCTAGTTATGATGTTGA
ATTCAAAATGAGCAATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAATATTTCGACTGAAAAATCACCTATAT
TAAAAATGCATATTGATGGTGACCTGAAAGGCAGTTCCGTAGGTTATAGAAAGTTAGAAATTGACTTTTCAAAACGTGAA
AACAGCAAATTATCAGTCATTGAATTTTTAAGTTATAAACCAGCGAAAAAATAG

Protein sequence :
MGYLKRFALYISVMILMFAIAGCGKGNETKEGSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKGDKGMWTIYT
DFAKSNKPGELDDEGMVLNLDRNTRTAKGHYFVTTFYRNGKLPDEKNYKIEMKNNKIILLDEVKDDKLKQKIENFKFFGQ
YANLKELKKYNNGDVSINENVPSYDVEFKMSNKDENVKQLRSRYNISTEKSPILKMHIDGDLKGSSVGYRKLEIDFSKRE
NSKLSVIEFLSYKPAKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 1e-115 100
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 1e-111 97
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 3e-112 97
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 2e-103 93
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 2e-103 93
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 4e-103 89
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 1e-98 85
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-97 84
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 8e-96 82
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-96 82
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-85 82
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-90 81
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-93 80
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 1e-93 80
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 1e-93 80
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 5e-92 79
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 2e-92 79
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 2e-92 79
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 1e-93 79
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 1e-93 79
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 2e-91 79
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-93 79
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 6e-89 78
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 3e-91 78
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 1e-91 78
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 6e-91 78
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 6e-88 77
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-88 77
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 2e-88 77
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 1e-91 77
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 6e-92 76
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 5e-91 76
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 5e-91 76
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 5e-91 76
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 3e-90 75
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-80 66
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 5e-77 65
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 5e-77 65
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 5e-81 65
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 7e-78 64
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 7e-78 64
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 3e-76 64
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 3e-76 64
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 3e-80 64
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-68 64
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 1e-71 63
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 2e-75 62
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 3e-76 62
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 3e-76 62
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 3e-74 61
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 3e-74 61
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 4e-74 60
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-63 58
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-63 58
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 2e-60 57
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 4e-56 53
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 4e-56 53
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-54 53
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 2e-58 52
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 6e-54 50
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-50 49
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 9e-51 49
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 9e-51 49
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 5e-54 49
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 5e-54 49
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 5e-54 49
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 1e-56 49
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 1e-56 49
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 4e-59 49
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 1e-52 49
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 1e-51 49
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 6e-51 48
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 2e-49 48
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 2e-49 48
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 2e-49 48
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 2e-47 47
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 2e-47 47