Gene Information

Name : SAR0438 (SAR0438)
Accession : YP_039889.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 467510 - 468295 bp
Length : 786 bp
Strand : +
Note : No significant database matches. Similar to SAR0439, 63.672% identity (63.922% ungapped) in 256 aa overlap, SAR0442, 63.118% identity (63.602% ungapped) in 263 aa overlap, SAR0443, 60.902% identity (62.548% ungapped) in 266 aa overlap, and SAR0444, 52.107

DNA sequence :
ATGATGGGAAATATAAAAAGTTTTGCATTGTACATAAGTATCTTGCTTTTAATAGTTGTTGTAGCAGGTTGTGGCAAAAG
TGATAAAACAAAAGAAGATTCCAAAGAAGAACAAATTAAAAAGAGCTTTGCGAAAACATTAGATATGTATCCAATTAAGA
ATCTCGAGGACCTATATGATAAAGAAGGATATCGAGATGGCGAATTTAAAAAGGGAGATAAGGGGACGTGGACTTTACTC
ACAAGTTTTTCAAAAAGTAACAAACCGGATGAAATAGATGACGAAGGCATGGTTTTATATCTAAATAGAAATACCAAAAA
GGCAACAGGTTATTATTTTGTAAATAAAATTTATGATGATATTAGCAAAAATCAGAATGAGAAAAAATACCGTGTTGAAC
TTAAAAATAATAAGATTGTTCTTTTGGATAATGTAGAAGACGAAAAACTTAAACAAAAAATTGAAAATTTTAAATTTTTT
AGTCAGTATGCGGATTTTAAAGATTTAAAAAATTATCAAGATGGAAGTATAACAACTAATGAAAATATTCCTAGTTATGA
AGCAGAATACAAATTGAATAATAGTGATGAAAATGTAAAAAAACTTAGAGATATTTATCCAATTACAACGAAAAAGGCTC
CAATATTAAAGTTACATATAGATGGTGATATAAAAGGAAGTTCAGTTGGATACAAAAAAATAGAATATAAATTTTCAAAA
GTTAAAGATCAAGAGACAACATTAAGAGATTATTTAAATTTTGGGCCGTCTGATGAAGATAGCTAA

Protein sequence :
MMGNIKSFALYISILLLIVVVAGCGKSDKTKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTLL
TSFSKSNKPDEIDDEGMVLYLNRNTKKATGYYFVNKIYDDISKNQNEKKYRVELKNNKIVLLDNVEDEKLKQKIENFKFF
SQYADFKDLKNYQDGSITTNENIPSYEAEYKLNNSDENVKKLRDIYPITTKKAPILKLHIDGDIKGSSVGYKKIEYKFSK
VKDQETTLRDYLNFGPSDEDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 1e-102 100
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 4e-96 90
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 4e-96 90
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 1e-95 90
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 2e-89 82
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 2e-89 82
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 2e-90 82
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 3e-89 79
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 1e-87 78
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 1e-87 78
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 5e-77 75
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-77 75
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-77 74
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 3e-78 72
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 3e-78 72
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-76 70
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-76 70
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-73 68
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 1e-68 68
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 1e-68 68
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 4e-71 67
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-68 67
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 1e-71 66
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 1e-71 66
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 7e-72 65
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-71 65
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 3e-69 65
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 3e-69 65
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 4e-66 65
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 9e-69 64
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 9e-69 64
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 4e-72 64
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-63 64
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 2e-68 63
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 2e-68 63
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-70 63
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 2e-69 63
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 2e-67 62
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-67 62
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 6e-67 62
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 6e-67 62
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 3e-68 62
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 1e-69 62
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 9e-67 61
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 3e-65 61
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 5e-67 61
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 1e-67 61
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 9e-67 61
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 9e-67 61
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 2e-66 60
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 2e-66 60
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-66 60
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 2e-54 57
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-56 57
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-56 57
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 4e-45 57
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 4e-45 57
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 2e-55 54
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-50 54
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 2e-51 53
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 1e-49 53
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 1e-49 53
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 3e-51 52
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 3e-51 52
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 3e-51 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 1e-51 51
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-46 50
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 6e-49 50
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 6e-49 50
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 1e-49 50
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 1e-49 50
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 1e-49 50
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 3e-45 49
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 2e-45 49
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 2e-45 49
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 5e-47 46
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 5e-47 46