Gene Information

Name : SAR0435 (SAR0435)
Accession : YP_039886.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : superantigen-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 464528 - 465226 bp
Length : 699 bp
Strand : +
Note : these proteins share structural homology to known superantigen proteins but do not exhibit any of the properties expected such as histocompatibility complex class II binding or broad T-cell activation

DNA sequence : 
ATGAAATTAAAAAATATTGCTAAAGCAAGTTTAGCACTAGGGATTTTGACAACAGGGATGATTACAACTACTGCTCAGCC
AGTAAAAGCAAGTGAGCAAAGCAGATTATCAGTTACTTCAAACGACACGCAAGAATTAAAAAAATACTACAGTGGAACAG
GATATAATTTTCAAAATGTGAGTGGTTATAGAGAAAAGGATAAAATGAACATTATTGATGGGACACAACTTAATGTAGTT
ACTTTACTTGGTACAGACAAAGAAAGATTTAAAGATTATGACTATGATTATGAAGGGTTAGATGTCTTTGTAGTCAGAGA
AGGATCAGGTAAACAAGCTGAAAATATTTCAATAGGTGGAATTACCAAGACGAATAAAAACGATTATAAAGATTTCGTAA
ATAATGTAGGTCTAGAAATAACTAAACCAACAGGACATAATACAGCAACAAGACAAGCAGAAACTTATAGAATTAATAAA
GAAGAAATTTCATTAAAAGAATTAGATTTCAAATTAAGAAAACATTTAATTGAAAATCATGAACTTTATAAGACAGAGCC
TAAAGACGGTAAAATTAGAATTACTATGAAAGGTGGCGGCTACTATACTTTTGAATTAAATAAAAAATTACAGCCTCATC
GTATGGGTGATGTAATTGATGGTAGAAATATAGAAAAAATTGAAGTCGATTTATATTAA

Protein sequence : 
MKLKNIAKASLALGILTTGMITTTAQPVKASEQSRLSVTSNDTQELKKYYSGTGYNFQNVSGYREKDKMNIIDGTQLNVV
TLLGTDKERFKDYDYDYEGLDVFVVREGSGKQAENISIGGITKTNKNDYKDFVNNVGLEITKPTGHNTATRQAETYRINK
EEISLKELDFKLRKHLIENHELYKTEPKDGKIRITMKGGGYYTFELNKKLQPHRMGDVIDGRNIEKIEVDLY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0435 YP_039886.1 superantigen-like protein Virulence vSa¥á Protein 4e-97 100
SAS0396 YP_042522.1 superantigen-like protein Virulence vSa¥á Protein 1e-79 84
set26 NP_645211.1 superantigen-like protein Virulence vSa¥á Protein 1e-79 84
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 3e-58 67
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 3e-58 67
SACOL0478 YP_185368.1 superantigen-like protein Virulence vSa¥á Protein 5e-53 65
set11nm YP_001331434.1 superantigen-like protein Virulence vSa¥á Protein 5e-53 65
SAUSA300_0407 YP_493121.1 superantigen-like protein Virulence vSa¥á Protein 5e-53 65
SAKOR_00417 YP_008490601.1 Exotoxin Not tested vSa¥á Protein 1e-51 63
SAMSHR1132_03810 YP_005324902.1 exotoxin Virulence vSa¥á Protein 1e-53 63
set10 NP_373636.1 superantigen-like protein 5 Virulence vSa¥á Protein 8e-39 50
set5nm YP_001331426.1 superantigen-like protein 5 Virulence vSa¥á Protein 6e-39 50
SAUSA300_0399 YP_493113.1 superantigen-like protein 5 Virulence vSa¥á Protein 6e-39 50
SAS0388 YP_042513.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-38 50
set20 NP_645203.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-38 50
set10 NP_370949.1 superantigen-like protein 5 Virulence vSa¥á Protein 8e-39 50
SAKOR_00409 YP_008490593.1 Exotoxin Virulence vSa¥á Protein 4e-39 50
SAMSHR1132_03750 YP_005324897.1 exotoxin 3 Virulence vSa¥á Protein 2e-35 49
set3 YP_039879.1 superantigen-like protein 5 Virulence vSa¥á Protein 1e-36 48
SAR0422 YP_039874.1 superantigen-like protein Virulence vSa¥á Protein 7e-36 46
SAS0384 YP_042509.1 superantigen-like protein Virulence vSa¥á Protein 2e-37 46
set16 NP_645199.1 superantigen-like protein Virulence vSa¥á Protein 2e-37 46
set6 NP_370946.1 superantigen-like protein Virulence vSa¥á Protein 3e-35 46
set6 NP_373632.1 superantigen-like protein Virulence vSa¥á Protein 3e-35 46
SAMSHR1132_03720 YP_005324894.1 exotoxin Virulence vSa¥á Protein 1e-33 45
SAKOR_00404 YP_008490588.1 Exotoxin Virulence vSa¥á Protein 8e-34 45
SACOL0468 YP_185358.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 44
set1nm YP_001331422.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 44
SAUSA300_0395 YP_493109.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 44
set6nm YP_001331427.1 superantigen-like protein Virulence vSa¥á Protein 1e-29 43
SAUSA300_0400 YP_493114.1 superantigen-like protein Virulence vSa¥á Protein 1e-29 43
set4 YP_039882.1 superantigen-like protein Virulence vSa¥á Protein 2e-30 43
set21 NP_645204.1 superantigen-like protein Virulence vSa¥á Protein 2e-31 43
set7nm YP_001331428.1 superantigen-like protein 7 Virulence vSa¥á Protein 1e-27 43
SAUSA300_0401 YP_493115.1 superantigen-like protein 7 Virulence vSa¥á Protein 1e-27 43
SAS0389 YP_042514.1 superantigen-like protein Virulence vSa¥á Protein 2e-31 43
SAS0393 YP_042518.1 superantigen-like protein Virulence vSa¥á Protein 2e-29 42
set25 NP_645208.1 superantigen-like protein Virulence vSa¥á Protein 2e-29 42
SAKOR_00410 YP_008490594.1 Exotoxin Virulence vSa¥á Protein 2e-27 42
SAKOR_00413 YP_008490597.1 Exotoxin Virulence vSa¥á Protein 3e-29 42
set7 NP_370947.1 superantigen-like protein Virulence vSa¥á Protein 5e-23 41
set7 NP_373633.1 superantigen-like protein Virulence vSa¥á Protein 2e-23 41
set7 YP_493110.1 superantigen-like protein Virulence vSa¥á Protein 9e-24 41
SACOL0469 YP_185359.1 superantigen-like protein Virulence vSa¥á Protein 9e-24 41
set2nm YP_001331423.1 superantigen-like protein Virulence vSa¥á Protein 9e-24 41
SAUSA300_0404 YP_493118.1 superantigen-like protein Virulence vSa¥á Protein 9e-29 41
SACOL0474 YP_185364.1 superantigen-like protein Virulence vSa¥á Protein 9e-29 41
set14 NP_370953.1 superantigen-like protein Virulence vSa¥á Protein 9e-29 41
set14 NP_373640.1 superantigen-like protein Virulence vSa¥á Protein 9e-29 41
set10nm YP_001331431.1 superantigen-like protein Virulence vSa¥á Protein 9e-29 41
SAKOR_00405 YP_008490589.1 Exotoxin Virulence vSa¥á Protein 1e-23 41