
|
Name : SAR2071 (SAR2071) Accession : YP_041441.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 2152640 - 2152846 bp Length : 207 bp Strand : - Note : Similar to bacteriophage phi ETA hypothetical protein Orf35 TR:Q9G010 (EMBL:AP001553) (68 aa) fasta scores: E(): 2.7e-23, 98.52% id in 68 aa, and to Staphylococcus aureus temperate phage phiSLT hypothetical protein Orf77 TR:Q9B0F0 (EMBL:AB045978) (77 aa) DNA sequence : GTGACACAATACTTAGTCACAACATTCAAAGATTCAACAGGACGTAAACATACACACATAACTAAAGCTAAGAGTAATCA AAGGTTTACAGTTGTTGAGGCAGAGAGTAAAGAAGAAGCGAAAGAGAAGTACGAGAAACAAGTTAAAAGGGATGCAGTTA TTAAAGTGGGTCAGTTGTTTGAAAATATAAGGGAGTGTGGGAAATGA Protein sequence : MTQYLVTTFKDSTGRKHTHITKAKSNQRFTVVEAESKEEAKEKYEKQVKRDAVIKVGQLFENIRECGK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAKOR_01953 | YP_008492141.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 5e-18 | 100 |
| SAUSA300_1948 | YP_494599.1 | phi77 ORF069-like protein | Not tested | ¥ÕSa3 | Protein | 5e-18 | 100 |
| SAUSA300_1948 | YP_494599.1 | phi77 ORF069-like protein | Not tested | ¥ÕSa3 | Protein | 5e-18 | 100 |
| SAUSA300_1416 | YP_494113.1 | phiSLT ORF 81b-like protein | Not tested | ¥ÕSa2 | Protein | 1e-18 | 96 |
| SAOV_1938c | YP_005737382.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 2e-17 | 93 |
| SAOV_0309 | YP_005735826.1 | hypothetical protein | Not tested | ¥ÕSa1 | Protein | 2e-17 | 93 |
| SAOV_1095 | YP_005736590.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 2e-17 | 93 |
| SAV0877 | NP_371401.1 | hypothetical protein | Not tested | ¥ÕSa1 | Protein | 5e-14 | 83 |
| SAV1972 | NP_372496.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 5e-13 | 81 |
| SA1782 | NP_375081.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 1e-14 | 81 |